KEGG   Aspergillus clavatus: ACLA_039040Help
Entry
ACLA_039040       CDS       T01148                                 

Definition
(RefSeq) glutamate decarboxylase, putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
act  Aspergillus clavatus
Pathway
act00250  Alanine, aspartate and glutamate metabolism
act00410  beta-Alanine metabolism
act00430  Taurine and hypotaurine metabolism
act00650  Butanoate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
Module
act_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ACLA_039040
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACLA_039040
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACLA_039040
   00430 Taurine and hypotaurine metabolism
    ACLA_039040
Enzymes [BR:act01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ACLA_039040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 4702803
NCBI-ProteinID: XP_001271115
UniProt: A1CKL5
LinkDB All DBs
AA seq 571 aa AA seqDB search
MSVTSPQSRAEEVRSLLGAVEDLLIPFIQSADDITLGHAQLQNGDDGTNGVNGHSKSGTS
LVDYKKPEELRDILQLSLPEKGARQDGLIEVLRKVLKYSVNTWHQGFLDKLYASTNAPGV
ASELILAALNTNVHVYQVSPALTVIEKYTGQQLAALFGLTGPRAGGISVQGGSASNTTSI
VIARNNLYPDTKKNGNGDYKFVLFTSDHGHYSIEKAAQMLGLGSSSVWPVPVDKQGRMIP
AELEKLVEKALQEKRTPFYVNGTAGTTVMGSFDPFDEIAAICKKYNLWFHVDGSWGGSFV
FSKRQKHKLAGAEKANSIAINPHKMLGVPVTCSFLLAADLRQFHRANTLPAGYLFHNEDT
ESQPDSDSISAENELGVDSPEVWDLADLTLQCGRRADSFKLFLGWTYYGTEGYEQQIDTA
CDLAAHLATIVSKNSNFILVSENPPPCLQVCFYYAPGGQLVHPRGIVSNETERAKANSKV
TEQVTHALVQRGFMVDFAPPSGDDNAVGNGKFFRCVVNVQTTRETVEGLVRAIEEVGPAI
VEKLKAEAASSAPKIKRRPGERGHGPVVHHP
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcacgtcaccacagagtcgcgcggaagaagtgcggagtcttctcggcgcagtc
gaagatctcctcatacctttcattcaatccgcggatgacattactcttggtcatgcgcaa
ctgcagaacggcgacgatgggacaaacggcgtgaacggacacagcaagagcggaacatct
ctagttgactacaagaaaccggaagagcttcgggacattttgcaattatcattgccggaa
aagggcgccagacaagacggcctgatcgaggttcttcgcaaagtcctgaaatactccgtc
aacacatggcatcaaggcttccttgacaaattatatgcgtcaacgaacgctcccggtgta
gcatccgagctcatcttggccgctctcaatacgaatgtgcatgtgtaccaagtctcaccg
gctttgaccgtgatcgaaaagtacacaggacagcaactggctgcgttatttggtctgacg
ggaccacgggctggtggaatctcagtacaagggggttcagcgtcgaacactacgtcgatt
gtgattgcgcgtaacaatttatacccggatacgaagaaaaatggcaacggcgattacaaa
tttgtgctgtttactagtgatcacggtcactacagtatcgagaaggcggcgcaaatgctg
ggtttaggaagtagctcagtgtggccggtccctgtggacaagcaaggacgcatgattccg
gcggagctagagaaactggttgagaaagcgctccaggagaagaggactccattttatgtc
aacgggactgcgggcacgacggtaatgggctcctttgacccgtttgacgagatcgccgcc
atctgcaagaaatacaacctctggttccacgtggacggttcatggggtggctcattcgtt
ttctccaaacgccagaagcacaagctcgccggtgcagaaaaagcaaacagcatcgccatc
aatccccacaaaatgctcggcgtcccagtgacatgctccttcctcctggcggcagacctc
cgccaattccaccgagccaacaccctcccggcgggctacctgttccacaacgaagacacc
gaatcacagccagatagtgattctatttctgcggagaacgagcttggcgttgattccccg
gaggtctgggatctggcagaccttactttgcagtgcggacgacgcgcggattcgttcaag
ctcttcctgggctggacttactacggcacggagggctatgagcagcagatcgatacggcc
tgcgatctcgccgcgcacctggccacgatcgtatcaaaaaattccaacttcattctggtc
agcgagaacccgccgccctgtctgcaggtatgcttctactacgctccaggtggacagctc
gtccatccccgtggcattgtgtcaaacgagaccgagcgtgcaaaggccaatagcaaagtc
acggaacaagtgacccacgctttagtgcaaaggggcttcatggttgactttgcgcctccg
agcggcgatgataatgctgtcgggaacggcaagttcttccgctgcgtggtcaatgtccag
acgacgcgtgaaacggtcgaaggtctcgtgcgtgccatcgaggaggtgggcccggctatt
gttgagaaactcaaggccgaggctgcgtcttcggcacctaagatcaagcggcggcctggc
gagaggggccatgggccggttgttcaccatccttga

DBGET integrated database retrieval system