KEGG   Aspergillus clavatus: ACLA_039060Help
Entry
ACLA_039060       CDS       T01148                                 

Definition
(RefSeq) DNA ligase I, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
act  Aspergillus clavatus
Pathway
act03030  DNA replication
act03410  Base excision repair
act03420  Nucleotide excision repair
act03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:act00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ACLA_039060
   03410 Base excision repair
    ACLA_039060
   03420 Nucleotide excision repair
    ACLA_039060
   03430 Mismatch repair
    ACLA_039060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:act03032]
    ACLA_039060
   03400 DNA repair and recombination proteins [BR:act03400]
    ACLA_039060
Enzymes [BR:act01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACLA_039060
    6.5.1.6  DNA ligase (ATP or NAD+)
     ACLA_039060
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ACLA_039060
DNA replication proteins [BR:act03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ACLA_039060
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ACLA_039060
DNA repair and recombination proteins [BR:act03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ACLA_039060
   NER (nucleotide excision repair)
    Other NER factors
     ACLA_039060
   MMR (mismatch excision repair)
    Other MMR factors
     ACLA_039060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 4702793
NCBI-ProteinID: XP_001271117
UniProt: A1CKL7
LinkDB All DBs
AA seq 834 aa AA seqDB search
MSSPAKKRKREVPQSNPQPFRSIASFFQGQASKQAEKTLQSIDSAPETVVEDGLSDEALA
RKLQAEFDKEDAPAGGIGIPNNEPSLPASSSTDNGLEPPRKVPKTHTLSLQSSVGTEDTI
CSAILFDQSPLTFDSTKCAAELTVHWVAEGGNASYALLTRAFVLANSTTSRIKIVDTLVN
LLRVLIEGDPTSVLPAVWLATNSISPPYKEVELGLGGSSISKALKKVYGLNPQGLKTLYD
RYGDAGDVAFEAKKRQSFTLMKPKPLTIKGVYQSLRKIATSKGSGSQESKQRIVEKLLQD
TRGAEESRYIVRTLVQNLRIGAVKTTMLIALARAFLYSKPEGAEFPVRSQQNLARLKKEE
LTEVYNNAEEIVKASYARHPNYNDLVTCLLEIGVSDELLLRCGLQLHIPLRPMLGSITRD
LSEMLTKLQGRGFSCEYKYDGQRAQVHCDDKGKVSIFSRHLENMTEKYPDLVSLVPQIRG
ESVSSFILEGEVVAVDNETGELQTFQVLTNRAKKNVDIGGIRINVCLFAFDLMYLNGEPL
LDRPFRERRELLRSLFVEIPNQFTWVKSLDATSADSETVLEFFKGALDAKCEGIMVKVLD
NVPKANIKQPQGDSTMTDGIANAAGEAPPEKPSKGARRKALLSTYEPDKRLESWLKVKKD
YSTSSETLDLIPVAGWHGQGRKAKWWSPILMAVRNPESGSLEAVTKCMSGFTDKFYQANK
DKYAEGTPNVISRPAYVEYHGEPDVWFEPQEVWEMAFADITLSPTYTAALGLVSDERGLS
LRFPRFLKVRDDKSIDEATTSDYLALLWRKQAERKIEEEQQQPDKAERLGWQEE
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcccggctaaaaagcgcaaaagagaggttccgcaatcgaatccccagcctttt
cggagcatagcgtcattcttccagggccaagccagcaaacaagctgaaaagacgctgcag
agtattgattctgctcccgaaactgtagtggaagatggactttctgatgaagctcttgcg
cgcaagcttcaagctgagtttgataaagaggatgcgccagctggggggataggcattcct
aacaatgagcctagcctaccagcttcaagctcgactgataatggtctggagccaccaaga
aaagtgccgaagacgcatacgttatcactacaatcttctgttggcacagaagacactatc
tgctctgcgatactgttcgaccagagtccgttgacgtttgactcaaccaaatgcgcagca
gagctaacggtccattgggttgccgagggggggaacgcctcatacgccctgttgacccga
gcattcgtattggcgaattcaactacaagccggatcaagattgttgatacgcttgtcaac
ctccttcgcgtgctcatcgaaggcgatccgacaagtgttttacccgccgtctggttggct
acgaactctatttctccgccttataaggaagtcgagcttggcttgggtggctcttctata
tcaaaggctttgaagaaggtctatgggctgaatccgcagggtctcaaaacgctatatgat
cggtatggggatgccggcgatgtggcattcgaggcaaagaaaaggcagagctttacatta
atgaagccgaaaccattgaccatcaagggtgtctatcaatctttgaggaagattgccacg
agtaaaggcagtggaagccaggaatcgaaacaaagaatcgtggagaagttactacaagac
acacggggtgcagaggaaagccggtatattgtgaggacgctcgttcaaaacctacgcatc
ggggctgtgaaaactactatgctgattgcgcttgcgcgagcctttctatactcaaaaccg
gagggagcggagtttccagtccgatcccagcagaatttggcacgtctgaagaaggaagag
ctcaccgaagtctacaacaatgcagaggagattgtgaaggcctcatatgcacgacatcca
aattacaatgatttggtcacatgtcttctcgagatcggagttagcgacgaactccttctc
cgctgcggactacagctacatattccgctcagaccgatgctgggcagtatcacacgagat
ttgtcggagatgcttacgaagcttcaaggacggggttttagctgtgaatacaagtatgac
ggacagcgagcgcaggtccattgtgacgacaaggggaaggtatcaatattctctcgccac
ctggagaacatgacggagaaatacccggatcttgtgtcccttgtcccgcaaatccgaggg
gaaagcgtgtcgagcttcattctagaaggggaggtcgttgcggtggataatgaaaccggt
gaactccaaacgttccaagtcctgaccaatcgagcaaagaagaatgtggatatcggcggc
atcaggatcaatgtctgtctttttgcgttcgacttgatgtatctgaacggcgagccgttg
ctggatcggcctttccgcgaacgcagggaactgctccgcagcttgtttgtcgagatcccc
aaccagtttacctgggtcaagagcttggacgctacatcggccgattccgagaccgttctg
gaattcttcaagggcgccctcgacgccaagtgcgaagggatcatggtcaaagtgctcgac
aacgtgccgaaagccaacatcaagcaaccgcaaggcgattccacgatgaccgatggcata
gcaaacgcggcaggagaagcaccacccgaaaaaccctccaagggcgcccggcgaaaagcc
ctcttgtcaacctacgagcccgacaaacggctcgagtcctggctcaaagtcaagaaagac
tacagcacctcctcagagacgctggacctaatccccgtggctgggtggcacggccaaggc
cgcaaggccaagtggtggtctccgatcctcatggccgtccgcaacccagaatccggcagc
ctcgaagcggtcacgaagtgcatgtccggcttcacggacaaattctaccaggccaacaag
gacaaatacgccgagggcacgccgaacgtcatctcgcgccccgcgtacgtcgagtaccac
ggcgagccggacgtgtggtttgagccgcaggaggtctgggagatggcgtttgcggatatc
acgctcagcccaacgtacacggcggccctcgggctggtcagcgacgagcgcggcctgagt
ttgcggttcccgcggttcctcaaggtccgcgacgataagtcgatcgacgaggcgaccacg
tcagactacctcgctctgctgtggaggaaacaggcagagcggaaaattgaggaggagcag
cagcaacccgacaaggccgagagattgggctggcaggaagagtga

DBGET integrated database retrieval system