KEGG   Aspergillus clavatus: ACLA_049360Help
Entry
ACLA_049360       CDS       T01148                                 

Definition
(RefSeq) Glycosyl hydrolase, family 15, putative
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
act  Aspergillus clavatus
Pathway
act00500  Starch and sucrose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_049360
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ACLA_049360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 4703923
NCBI-ProteinID: XP_001271890
UniProt: A1CHV9
LinkDB All DBs
AA seq 630 aa AA seqDB search
MRMKQFLTISSGLLTVVCGHLNDNPAQIVIAGGAIIPETTDPIESWLNMEIPYAFDGVLN
NIGPDGAKATGAGSGIVIASPSHSNPDYYYTWTRDAALTIKYLVESLASDDDPGLRRIIE
RYITSQAHLQTISNPSGSLSSGGLGEPKLRADGSAFHGPWGRPQRDGPALRATALIAYAN
LLIDHGKSSTAYSTVWPIIQNDLSYVTEFWNATTFDLWEEVRGSSFFTTAVQYQALVQGA
SLAQKLGDSCPHCQTQAPQILCFLQTFWTGSSILANFGSDRSGKDANSLLGTIHTFDPNA
GCDEHTFQPCSSRALANHKVVVDSFRSLYPINSDISPGQAVAIGRYPEDVYQGGHPWYLC
TLAAAEQLYDALYQWELMGNLSISDMSLVFFRDLYPSTATGTYSRGTDTFAAVTAAVKVY
ADGFLRIIQKYTPSTGALAEQFSRSDGSPLSALDLTWSYAALLTAHRARERALVLNPTTT
SPPRSPSSTIPPPLPRTCTPSSAKGPYVPVTNVTWPRPTCLTPPRTVAVRFNVLASTVFG
EDILLVGSIPELGEWDVRNQGLKLNANAYSGVTPLWYRTVMLQSGVDFEFKFVRVNRDGE
VRWEEGLNRESVVPRECGVVNATINAVWRS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgaagcagttcctgacgatcagttccggtctcctgaccgttgtctgcggccat
ctgaacgacaaccccgctcagatcgtaattgctggaggtgcaataatacctgaaacaacg
gatcctatcgagtcatggctgaatatggagattccgtacgcttttgatggcgtgttgaac
aacattggtccggatggtgccaaggcgaccggcgccggctcaggcattgtcatcgccagc
cctagtcatagtaatcccgattattactacacctggactcgagatgctgcccttaccatc
aaatacttggttgagtctctcgcctctgacgacgatcccgggcttcggagaatcatcgag
cgatacataacgtcgcaggcgcatttacaaaccatttcaaatccctctgggagtctttca
agtgggggtctgggggaacccaaattgagggccgacggatctgcattccatggtccttgg
ggtcgtcctcaaagagatggacccgcgttgagagcaacagcgttgattgcctatgccaat
ttgctgattgatcacgggaagtcttcaacagcatactcgaccgtatggccaatcattcaa
aacgatctctcttatgttacggagttttggaacgcaacaaccttcgacctttgggaggag
gttcgtggctcttctttcttcactactgcggtgcagtatcaggcgcttgttcagggtgcg
tctctcgcccagaaactgggagattcgtgcccacactgtcaaacccaggcgcctcagatc
ctttgcttccttcaaaccttctggactgggtcatctatcttggccaattttggcagtgat
cgctcagggaaagacgccaattccctgctaggcaccatccacacatttgaccccaatgca
ggctgcgacgagcacaccttccagccatgctctagtcgcgcactggcaaaccataaggtg
gtcgttgactcctttcgctcgctatatccaatcaactcggacatctcgccgggccaggct
gtggccataggtcggtatccggaggatgtctaccaaggcggacatccgtggtatctatgc
acgttggctgcggcagaacagctctatgatgcactctaccagtgggagctgatggggaac
ctctccatcagcgacatgagtcttgtgtttttccgcgacctgtacccatccacggcgaca
ggaacgtactccagaggcacagacacattcgcagccgtaactgccgctgtcaaggtctat
gcagacgggttcctacgcatcatacaaaaatacaccccatctaccggcgccctcgcagag
caattctctcgctccgacggctcgcctctctccgcactcgatctcacatggtcctatgcc
gcccttctcacagcccatagagccagagagcgagctctagtgttaaatcctactaccacc
tcaccacctcgctccccttcctctacaatccctcccccgctgccccgaacttgcacccca
tcctccgcaaaaggaccatacgtccccgttacgaacgtcacatggccccgtcccacgtgc
ctgacccccccgcgcaccgtcgctgtccgattcaatgtcctcgcatccacggtattcggc
gaggatatccttctcgtcggctcgattcccgagctgggcgagtgggatgtccggaaccaa
gggctaaagctgaatgcgaatgcgtattcgggcgtaacgccgctgtggtatcggactgtg
atgctgcagtctggtgtagattttgagtttaaatttgtccgtgtgaatagggatggagag
gtgagatgggaggaggggttgaatagggagagtgtggttccgagagaatgtggtgtggtt
aatgcaacgattaatgcagtttggaggtcatga

DBGET integrated database retrieval system