KEGG   Aspergillus clavatus: ACLA_050820Help
Entry
ACLA_050820       CDS       T01148                                 

Definition
(RefSeq) glutathione transferase, putative
Organism
act  Aspergillus clavatus
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 Zeta_toxin Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 4703787
NCBI-ProteinID: XP_001272036
UniProt: A1CIA5
LinkDB All DBs
AA seq 740 aa AA seqDB search
MDGSDLQRFPVDAHPSDLQPRSLSSLADDASTLAAAQQEQPQPQPEQQQQQQQHPHPHHQ
QSHQTHTQDLADSRDAPSLQPLQSALEHQELHAHRQQEHRHLHNVEHHLDTTPAFMRPVR
TGEPVGPVLMSSQLFHQKPSSYEEVSRAQAFAADHSGNGQHILPSLAHGVDQDVHPSQAL
SQGRSDRPDTVVMDQGHDNGADGMDDDARTAGLPLSQSFQQCLQMQQPGDGYTIASELAK
QETGLKDMKLVPDPPDLEYWREKLFNVDDMITLTEDQFRTYFPHVDNVYSHRSTQRYKRK
PFVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARQRDLCDVKIKITEYFPGYGVAAASDF
SGTCPADSSFPPAEFLPSVNSLFSSETSVGQRRDSQPFGVLTPNPTLPEGHPGANGERFF
TIQRVNGNGANGKNDGVSGGHRHTLDESDRVKKNSVQRYLLKEAREKKKAVTVSWIPSIF
FHRLTMPQSQTQQKTYHTKATGLAALTAINHSKEAELQLFGSCFCPFVQRVWIALEIKGI
PYQYIEVDPYQKPQSLLEVNPRGLVPALRHGDWGSYESSVLLEYLEDLHVGPPLLPPGDA
KLRAHCRLWTDHINRHIVPSFYRVLQEQEEARQSTNVQELQDGLRTLIAAADPEGPFFLG
SNISFVDVQIAPWILRFSRVLKPYRGWPEPEAGSRWAAWVNAIEVNEHVKATTSSDELYL
DSYERYARKYIIAELSSRDD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggatggctccgatctccagcgattccccgttgacgcccatccttctgatttacagccc
cgatcgttgtcgtcgctggcagacgacgcgtctacattggctgccgcccaacaagaacag
ccccaaccacagccagaacagcagcagcagcagcagcagcatcctcatcctcatcatcaa
caatctcaccagacacacacgcaggatctagccgattctcgggacgcgccatcgctccaa
cccctgcagtccgcgctcgaacaccaggagctccatgcgcatcggcagcaggagcaccgg
catcttcataatgtggagcatcacctcgacaccacaccggcattcatgcggccggtgcgg
acgggtgagccagtcggtcccgtgttgatgagctcccagctattccaccagaagccgtcc
tcctacgaggaagtttcgcgggcgcaggcgttcgctgcggaccactccggcaacggccag
catattctgccgagcttagcgcacggtgtcgatcaagatgtgcatcctagccaggcgctg
tcgcagggccgttccgatcggccagataccgttgttatggatcagggccatgataatggc
gccgacggcatggacgacgatgcgcggaccgcgggccttccgctgtcgcagtcgttccag
caatgtctacagatgcagcagccaggggatgggtatactattgcttcggagcttgcgaag
caagaaaccggcctcaaggatatgaagttggtaccagatccgcctgacctggaatactgg
cgagagaagctgtttaacgtggacgacatgatcaccttgacggaagaccaattccgaacc
tacttcccccacgtcgataacgtctactcccaccgctccacgcaacgctacaagcgtaaa
ccctttgtctcccactactgggactgcagactcaaaggccgaccgccggggacccccaag
tccgacgaccccaacaagaagaagcgcaagcgcaccgcccgccagcgagacctctgcgac
gtcaagatcaaaatcaccgaatacttccccgggtacggtgtggctgccgcgtcggacttc
tcgggaacgtgtccggcggactcatcgttcccaccggccgagttcctaccaagcgtgaac
tcattgttcagtagtgagaccagcgtgggccagaggcgcgacagtcagccctttggcgtg
cttacgccgaatcccactttgccggagggccaccccggggcgaatggagagaggttcttt
acgatccagcgggtcaatggcaatggcgcgaatgggaaaaacgatggcgtaagtggtggc
caccgacatacgcttgacgagagcgaccgggtgaagaagaacagcgtgcagcgttatttg
ctcaaagaagccagggaaaagaagaaggccgttacagtgagttggattccatcaatcttc
tttcacagactaaccatgcctcaaagccaaacccagcagaagacatatcacacgaaagcc
accggactagcggcattgactgcaataaaccactccaaagaagcggaattgcaattgttc
gggagttgcttctgcccctttgtgcagcgtgtttggatagccttggagattaaaggcatt
ccgtatcaatatattgaagtggacccgtaccaaaagccccagtcattgcttgaggtaaac
ccgaggggtcttgtcccagcattgcggcacggcgattgggggtcttatgagagttcggtt
cttctggaatatctcgaggatttgcacgtcggcccgccgctgctccctcccggagatgcg
aaattaagagctcattgccgactttggactgatcatatcaatcgtcacatcgtacccagt
ttctaccgcgtcctccaagaacaggaggaagcgagacaatccacgaacgtgcaagagctc
caggacggtctcagaacactgattgcggcggccgatccggaaggtccgttcttcttggga
tcgaacatctcatttgtggacgtccagatcgctccttggatccttcgattcagtcgggtg
ctgaaaccgtaccgtggctggccggagcccgaggcaggaagccgctgggctgcgtgggtg
aatgcaattgaagtcaatgagcatgtcaaggcgacaacgagctctgacgaactctacctg
gatagctatgaaagatatgctcgtaagtatatcatcgcggagctttcatcgcgtgatgac
tga

DBGET integrated database retrieval system