KEGG   Aspergillus clavatus: ACLA_054110Help
Entry
ACLA_054110       CDS       T01148                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:act03036]
    ACLA_054110
Enzymes [BR:act01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ACLA_054110
Chromosome and associated proteins [BR:act03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     ACLA_054110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 4707170
NCBI-ProteinID: XP_001274790
UniProt: A1C940
LinkDB All DBs
AA seq 1025 aa AA seqDB search
MSSKKPLEQTTPTASSMAAEFFQQEMNIHQSEDLKAKTIVVVHDACYGHRFSRPRTSKTA
LSYIVERPERIQACVLGVSAAYVHMACRHAGKRFAPHPDLDPHQLPVPPFQIRKTSRTLP
LSSAAVTHVHGTKWMEDLKTMCDAAESRLALNGKELVRPRSSGKDSDSTKKAPLNDGDLY
LCAESLNAFEGALGGVCEGIDAVFSPGATQRAFVCIRPPGHHCSVAQPSGFCWINNVHVG
ITYAAMTHGLTHAAILDFDLHHGDGSQDIAWEQNQKALSAVWNAANHKKTRIGYFSLHDI
NSFPCEGGDPEKVRNASVCIDKAHGQSIWNVHLETWKDEAEFWEIYGSKYTLILEKARAF
LRLHTERLLQAPHDTPPKAAIFISAGFDASEWEGSGMQRHQVNVPTEFYAKFTADVVRMA
EEEGLGVDGRVISVLEGGYSNRALTSGVLSHLAGLGDKTTMLADVNGTQQAGLAYEMFDR
LHIAEHASTETRRTLSDVEYDTEWWASTALEDLEALVYAPAPHVSKSKSAPTYFAPTRSF
TAKVVPSSRDRRSSGSQTSLDAIPLPEIPWTTAAHELSKILIPSHRQVSSYRPEELNAEA
SRLRRERHTAAVAAQKPGNVPGAATAPEASRMQLRTRKPKTSLPSSPQVETPKKQVMKSN
RRTTIDPASDLPGSSTDRSPIIKTTRRKSATSTPVASGKVVAIETAQGQPGALTTISDRS
AMSEVDAKNRPLVSSGSRRPSTSRVTTPKLSESNVPPVPPLPPATSVPSTVTRDSLGDEL
RTLLDDGKMTTAQDGETKRADVDDLTAGVKKLSIKLKVPTPEEHAAREKERKAAEDRKRR
TSKGTTSRPRLPKKASSAVAGSQTSVAKQTSRPSSSRGTQQAPDFNRSTQSAPIDIIKQE
SEEMLHEDPIASSPDPLVEPGMPQLNNVTIQRPRWERSVSASALAPESSSVPVTSPTMAQ
ESIPVQSKVYAPPTTAGQTMKGFPVFTASGPIPFAAAGLDNSNQENWASPSQDHSSQPDS
DHYPN
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaaagaagcccttagagcaaaccacacccaccgcatcttccatggcggcggag
ttctttcagcaggaaatgaatatacaccagtcggaagatctcaaggccaagactatagtt
gttgttcatgacgcctgctacggccatcgtttttcgcgaccacgaacctctaaaactgcc
ctgagctatattgtcgaacgcccggaaaggatccaagcctgcgtgctcggcgtgtctgca
gcatatgtccatatggcctgtcgacacgctgggaaacggttcgcgcctcatcctgatctt
gatcctcatcagctccctgtgccgcctttccagatccgcaagacatcgcgaactcttcct
ctcagctctgcagctgtgacccatgtgcatgggacgaagtggatggaagacctgaaaacc
atgtgcgacgcagcagagtcacgtcttgcgttgaacgggaaggagttggttcggccacgc
agttcaggaaaagacagtgactcgacaaagaaagccccgctcaacgatggcgatctatat
ctgtgcgctgaatcgttgaatgcctttgaaggtgcgctcggcggagtctgcgaaggtatc
gacgccgtgttcagtcctggtgcgacacaaagagcgtttgtttgcattcgtcccccaggc
catcattgttctgtcgcccagccatccggattttgctggatcaataacgtccacgtgggc
atcacttatgctgccatgacgcacggcttgacccatgctgccatcttggattttgacctc
caccatggcgacggctcgcaggacattgcgtgggagcagaaccagaaagcattgtcggca
gtctggaatgcggccaaccacaagaaaaccaggatcggctatttcagcttgcatgacatc
aactcgtttccctgtgagggtggtgatccggagaaagtgcgtaacgcgagtgtctgtatt
gacaaggcgcacgggcagtcgatctggaatgttcatctggagacgtggaaggatgaagcg
gagttctgggaaatctacggatctaagtatacgttgatactggaaaaggcacgcgcattt
ctgcgactccatacggaacgcctacttcaggccccccatgacacgccacccaaagccgca
atctttatctccgcagggtttgatgctagcgaatgggagggatccggtatgcagagacat
caagtgaacgttccaaccgagttctacgccaagttcactgctgatgttgttcggatggcg
gaggaggagggtctgggagtggatgggcgcgttatcagtgttcttgaaggaggctatagt
aaccgcgcgttgaccagtggagttctcagtcacctggccggtctgggagataaaacaacc
atgctggccgatgttaacggtacacaacaggcgggcctggcgtacgagatgtttgaccgt
ctgcatatcgcggaacacgcttcaacagaaactaggcgcacgctgtctgatgtcgaatac
gatactgagtggtgggcatcaaccgcgcttgaggatttggaggcgcttgtctatgcacct
gctccccacgtttccaagtcgaagtcagctcctacttattttgcgcccacgcggtccttc
acggctaaagttgtcccctcctcccgtgatcgaagatcgagtggctcccagacgagcttg
gatgccataccattaccagagataccctggactaccgcagcgcacgagctgtccaagata
ctcatccccagccaccggcaagtttcaagttatcgtccagaagagcttaatgctgaagcc
tcacgcctacggcgggaacgtcacacggctgcagtcgctgctcaaaagcccggcaacgta
ccaggagcggcaacagcgccggaagcaagtcggatgcaactccgcactcgcaagcccaaa
acctctcttcccagttccccacaggtggaaacaccgaagaagcaggtcatgaagagcaat
cgaaggaccactatcgaccctgctagtgatcttccaggctcatccactgaccgttcgcct
attattaagaccactcgcagaaagagcgcaacctcaacgccggtcgcttctggaaaggtt
gttgcaatcgagactgctcaagggcagcccggagctttaaccacgataagcgatagatcc
gcgatgtcggaagtggacgcgaagaaccggcctttagtatccagcggcagccgccgacct
agcacgtctcgtgtaaccacgcccaagctctctgagagcaatgtgcctccagtgcctcca
ttacctccagcgacgtccgtgccatctactgtcacacgtgactccctaggcgacgaactg
cgaacacttctggatgatggaaaaatgaccactgcgcaagatggtgaaacaaagcgtgca
gatgtagatgacttgaccgctggcgtcaaaaaactgagcatcaagttgaaggtaccgaca
ccggaggagcacgctgctcgcgagaaagagaggaaagcagccgaggaccgcaagagacgt
acgtccaagggaacaacttccagacctcgactgcccaaaaaggcttcgagtgccgtcgcg
ggctcacagacatctgttgcaaaacaaacctctcgaccatcatccagtcgcggcactcaa
caggcacccgacttcaatcgatcgactcagagcgcaccgatcgatatcatcaagcaggaa
agtgaggagatgctgcatgaagatcccattgcatcatcgcctgatcccctcgtggaacct
ggaatgccgcagctgaataatgtcactatccaacggcctcgctgggaaaggtcagtttcg
gcttctgctttagctccagagtcttcctctgtgccggtaacctcgcctaccatggcgcaa
gaatccattcctgtccaatctaaggtatacgcgccaccgactaccgcaggccagacgatg
aaaggcttccctgtgttcaccgcgagcgggccgattccatttgcggcagcaggtcttgat
aatagcaaccaggaaaattgggcgtcaccttctcaggaccattcttctcagcctgattct
gatcattaccccaattag

DBGET integrated database retrieval system