KEGG   Aspergillus clavatus: ACLA_068420Help
Entry
ACLA_068420       CDS       T01148                                 

Definition
(RefSeq) hexokinase Kxk, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
act  Aspergillus clavatus
Pathway
act00010  Glycolysis / Gluconeogenesis
act00051  Fructose and mannose metabolism
act00052  Galactose metabolism
act00500  Starch and sucrose metabolism
act00520  Amino sugar and nucleotide sugar metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
Module
act_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
act_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_068420
   00051 Fructose and mannose metabolism
    ACLA_068420
   00052 Galactose metabolism
    ACLA_068420
   00500 Starch and sucrose metabolism
    ACLA_068420
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_068420
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ACLA_068420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:act04131]
    ACLA_068420
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ACLA_068420
Membrane trafficking [BR:act04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ACLA_068420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4708030
NCBI-ProteinID: XP_001275241
UniProt: A1C5Z4
LinkDB All DBs
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKEFEDMFTVDRTKLKQVVDHFVKELEQGLTVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGAFDICQSKYRMPEELK
TGTAEELWEYIADCLQQFIDFHHEDEELSQLPLGFTFSYPATQDYIDHGVLQRWTKGFDI
DGVEGQDVVPPLEAILQKKGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAY
MDNVGSVPKLAHMNLPPDMPVAINCEYGAFDNEHIVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALIDLLDSRPGLIFEGQDTSKLRKPYLLDASFLAAIEEDPYENLEET
QELFQRELNIKPTQAELEMIRRLAELIGTRAARLSACGVAAICKKKNIERCHVGADGSVF
TKYPNFKARGAQALREILDWAPNENDKVSILAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNKDEMQKML
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaatcggtcccaagcgtcccccatcccgcaagggatcgatggccgacgtgcca
cagaacctcctgcagcaaatcaaggagttcgaagatatgttcaccgtggaccggaccaag
ctcaagcaggtggttgaccacttcgtcaaggagcttgaacagggcctcactgtggagggt
ggtaacatcccgatgaacgtcacgtgggttatgggattccccgatggagatgaacaagga
actttcctggccctggatatgggaggcaccaacctgcgtgtctgtgagattactctgacc
gaagagaagggtgctttcgatatctgccaatccaagtaccgtatgccggaggaattgaag
accggcactgctgaggagctgtgggagtacatagccgactgtcttcaacagttcattgat
ttccatcatgaagacgaggagctgtcacagttgcccttgggattcaccttctcctaccct
gctacacaggattacatcgatcatggtgttctccagcgctggaccaaggggtttgacatc
gatggcgttgaaggtcaagatgttgttcccccgctggaggcgatcctgcaaaaaaagggg
ctgcccatcaaagtcgctgccttgatcaacgatactaccggaaccctcattgcctcggcc
tacactgatcccgagatgaagattggttgcatcttcggcacaggtgtgaatgcggcttac
atggataatgtcggctcggtgcccaagctggcccacatgaaccttcccccggatatgcct
gtggcgatcaactgcgagtacggtgctttcgacaatgagcatattgttctcccccttacc
aagtatgatcacatcatcgatcgtgattcgcctcgtccgggccaacaggccttcgagaag
atgacggccggtctctacttgggagagatcttccgtctggccctcattgacctcctggac
agcaggccagggctcatcttcgagggtcaggatacctctaagctgcggaagccgtatctg
ctcgacgcctccttcctggctgccatcgaggaggatccttatgagaacttggaggaaacg
caggaactgttccagcgtgagttgaacatcaagcctactcaggcagagcttgagatgatc
cgccgtctggccgagttgatcggtactcgtgctgctcgtctctcagcctgtggtgtcgct
gctatctgcaagaagaagaacattgagcgctgccacgtcggcgccgacggttcggtattc
acgaaataccccaatttcaaggcccgtggtgcccaggcacttcgcgagatcttggattgg
gccccgaacgagaatgataaggtctccattctggcggccgaagatggttccggtgtcggt
gccgccctcattgctgccctgaccctgaagcgtgtcaaggccggtaacctggctggtatc
cgcaacaaggatgagatgcagaaaatgctgtag

DBGET integrated database retrieval system