KEGG   Aspergillus clavatus: ACLA_070560Help
Entry
ACLA_070560       CDS       T01148                                 

Definition
(RefSeq) alpha-glucosidase/alpha-amylase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
act  Aspergillus clavatus
Pathway
act00052  Galactose metabolism
act00500  Starch and sucrose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ACLA_070560
   00500 Starch and sucrose metabolism
    ACLA_070560
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ACLA_070560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Glyco_hydro_77 Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 4707606
NCBI-ProteinID: XP_001275450
UniProt: A1C6K3
LinkDB All DBs
AA seq 608 aa AA seqDB search
MPSQGAVMPGETRNKSVTQSGAYKPYILDMDREWWREIIIYEIYVQSFQDSNNDGIGDLR
GIIQRLDYLKDLGVDMVWLTPIYASPLEDQGYDIANYKAINPIFGTMEDWDELCEELHKR
GMKMMMDMVFNHTSSQHAWFLESKKSKDNPKRNWYFWRKGKTGKHGERLPPNNWESLFGG
PAWKYDESTDEWYMHLFSPSQPDLNWDNPEVRDAIYDVIDFWGSKGTDGFRFDVINLVSK
TPGLPDAPITRPDKFEQPAVPMFTNGPNIHIYMHEMNRKVLSKYTNCTVGEMPCGVDEYE
SSQYVAKERQELSMVFQFHHMDLDGEGGDKWDPRPWELWELEKVFRIWQQHMLGNNGWNS
LYMENHDQARAVSRFGNPDPRYRAVSAKMLATILLSLRGTPFLYQGQELGTPHPQNWKIE
HYDDVETHEYYKAQYKARKKMDPLREPDMSDVMYVIRLKGRDNARTPMLWDNTPNGGFCP
PEVKPWLRMNEEYADFNVETQTRDPDSVLNYFKKLIHIRRQHPLMSYGAYIPINPTDPKV
FSFLRTQGPWRSLVFCNWSADPSCFEIPEEIDIDLAVMLVANYEVKEWVLPRNVNLRAYE
TRVYSLRN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacaaggtgcagtcatgccgggcgagacacgaaacaagtccgtgacgcagtcc
ggcgcctataaaccgtacattctcgatatggatcgagaatggtggcgggaaattatcatc
tatgagatctatgtgcagtcctttcaggatagcaataacgatggtatcggtgatctacgc
ggcatcattcagcggctggattacctgaaggatctcggtgtagacatggtctggttgact
cctatttatgcatcaccccttgaagaccagggttatgatattgcaaactacaaggcaatc
aatcctattttcggcactatggaggactgggacgagctttgcgaagagctccacaagaga
ggtatgaaaatgatgatggacatggtgttcaaccacaccagctctcagcatgcatggttc
ctggagtcaaagaaaagcaaggataacccgaagcgtaactggtatttctggagaaaaggg
aagactggcaaacacggggagcgcttgcctccgaacaattgggagagtttattcggaggt
cctgcctggaaatatgatgagtctactgacgaatggtacatgcacttgttctccccatct
cagccagacttgaactgggacaacccggaagtgcgagacgccatttacgacgtgattgac
ttctggggcagtaagggaacagatggattccgttttgatgttatcaatcttgtctccaag
acacctggtcttccagatgcacccatcacaagaccggataaatttgagcagccagctgtt
ccaatgtttaccaatggcccaaatatccacatatacatgcacgagatgaaccgaaaggtc
ctgagcaagtacaccaactgcacagttggtgagatgccctgcggcgtagacgaatatgag
tcaagccagtatgtagccaaggagcgccaggagctttctatggtcttccagtttcatcac
atggatctggatggggaggggggcgataagtgggatcctcgtccatgggaactctgggag
cttgagaaggtattcagaatctggcagcaacatatgcttggtaacaatggttggaattct
ctttatatggagaatcatgatcaagcccgggccgtgtcgcgattcggcaaccccgatcca
cgttacagggcagtgtctgcaaagatgctagccacaatactgctgagcctcaggggaacc
ccgttcctctatcaaggacaggaactgggcacgcctcatccgcagaactggaagattgaa
cactatgatgacgttgagacgcatgaatattacaaagctcagtataaagcacgcaagaag
atggatcccttgagagagcccgatatgtccgacgtgatgtatgtcatccgtctgaaaggc
cgtgataatgcacgcacacccatgttgtgggataatacgcctaacggaggcttttgtccc
cctgaggtgaagccgtggctacggatgaacgaagaatacgccgatttcaatgtcgagact
cagacgagagatcccgactcggtcttgaattatttcaagaagctgatccatatccgcaga
caacacccgctgatgtcttacggagcttatatccccatcaacccaactgatccaaaggtg
ttctcgttcctacgaacacaggggccatggcgcagcctggtcttttgcaactggtcggcg
gatccttcttgcttcgagatccccgaggaaatcgacatcgacctagccgtgatgctggtc
gccaactacgaagtgaaggaatgggttcttcctcggaacgtcaacctgagggcatatgag
actcgggtttactcactccgtaactaa

DBGET integrated database retrieval system