KEGG   Aspergillus clavatus: ACLA_078620Help
Entry
ACLA_078620       CDS       T01148                                 

Definition
(RefSeq) glucan 1,4-alpha-glucosidase, putative
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
act  Aspergillus clavatus
Pathway
act00500  Starch and sucrose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_078620
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ACLA_078620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 4702553
NCBI-ProteinID: XP_001270539
UniProt: A1CLY4
LinkDB All DBs
AA seq 617 aa AA seqDB search
MRFLSTAVGIASVLGQLAGASPVSDISERSLRLEAFIAKEGLLSYQNILKAIGNTGSNAP
GTAAGLFIASPSLVNPDYFFTWTRDSALTIQGLIEIFLTANNFLGIDYQPLKGHIQDYIS
SQAILQNVTNPSGGLSDGAGLGEPKFEVNLNPYTGAWGRPQRDGPALRAIAMLTYMQHLI
KKGEKSVASDLVWPVVANDLAYVAQYWNSTGFDLWEEVDGSSFFTSAAQHRAMVEASTVA
KALGKPFETYDAIAPQILCFLQTYWNGKNIVSNINTNNGRTGIDLNSVLTSIHMFDPEAG
CDDATFQPCSSKALANHKVYVDSFRSIYTANAGRGKGQPANVGRYPEDVYQGGNPWYLAT
LAAAEQLYDALYVWRKQGSLTVTEISLPFFRDFSDTIKPGTYRANSATYQSLTRAVGNYA
DGFTSLVQESTPRNGSLAEQYTRDTGAPISAGDLTWSYAAFLSAVQRRASIVPGSWGAGR
ANTVPATCKAVTVRGTYAVAKPPFPFSSTKCIPAKRVPVTFWLTASTYWGQNVFMTGNTT
ALGNWNTTAGYALSSALYTEANQLWVASVEELKPGETIEYRFYKVEPDRSITWESTKKRV
YTVPTGCPMSPQLTATW
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcctcagtaccgctgtgggcatcgccagtgtcctcggccaactggccggtgct
tcgcctgtcagtgacatctctgaacgttccctgcgtctcgaggccttcatcgccaaggag
ggactcttgtcgtaccagaacatcctgaaggccattggcaacaccggcagcaatgctccg
ggcacggctgctggtctcttcattgccagcccaagccttgtgaacccagactatttcttc
acatggacccgtgattctgcgttgaccatccagggcctgatcgaaatcttcctgactgcc
aacaacttcctgggaatcgactatcagccgctcaagggccacattcaggactacatctct
tcgcaggccatccttcagaatgtcaccaatccgtctggcggactgtccgatggcgctgga
cttggtgaacccaagttcgaggtcaacttgaacccatacaccggagcctggggccgccct
cagcgggatggtcctgctcttcgggcgattgccatgttgacctacatgcaacacctgatc
aagaagggcgagaagtccgtcgcctccgaccttgtctggcctgtggttgccaacgatctg
gcctacgtcgcgcagtactggaacagcaccgggttcgatctctgggaagaggtcgatggc
tcctcgttcttcacgagcgcggcccagcaccgcgctatggtcgaagccagcaccgtggcc
aaggctctcggcaagccctttgagacctacgacgcgatcgctccccagattctctgcttc
ttgcagacctactggaacggaaagaatatcgtctccaacatcaacacgaacaatggtcgt
accggcatcgacctgaactccgtcctgaccagcattcatatgttcgaccctgaagcgggc
tgtgatgatgctacattccagccctgctcctccaaggccttggccaaccacaaggtctac
gtcgattccttccgctcgatctacacggccaacgctggacgcggcaagggccaacctgcc
aatgtcggtcgttacccggaggatgtctatcagggcggtaacccatggtatcttgctact
ctggctgcggccgagcagttgtacgatgccctctacgtgtggcgcaagcagggatcactc
accgtcaccgagatctcgcttccgttcttccgtgacttctccgacacgatcaagccgggc
acctaccgggccaactcggcgacctaccagtcgctgacccgggccgtcggcaactacgcc
gacggcttcaccagcctcgtgcaggaatccactcctcgcaacggctcgctagcggagcag
tacacgcgcgacacgggcgcgcccatctccgccggcgacctgacctggtcgtacgcggcg
ttcctgtcggcggtgcagcggcgggcctcgatcgtgccggggtcgtggggcgccgggcgc
gccaatacggtgccggccacctgcaaggccgtgacggtgcgcgggacgtacgcggtcgcg
aagccgcccttcccattctcgtcgaccaagtgcatccccgccaagcgcgtgcccgtcacc
ttctggctgacggccagcacgtactggggccagaacgtgttcatgacgggcaacaccacg
gcgctgggcaactggaacacgacggcgggctacgcgctcagctcggcgctgtacacggag
gcgaaccagctgtgggtggcgtcggtggaggagctcaagcccggcgagacgatcgagtac
cgcttctacaaggtcgagcccgaccgctcgatcacctgggagtcgaccaagaagcgggtg
tataccgtcccgactggttgccctatgtctccccagctcacggccacttggtaa

DBGET integrated database retrieval system