KEGG   Aspergillus clavatus: ACLA_086780Help
Entry
ACLA_086780       CDS       T01148                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
act  Aspergillus clavatus
Pathway
act00250  Alanine, aspartate and glutamate metabolism
act00410  beta-Alanine metabolism
act00430  Taurine and hypotaurine metabolism
act00650  Butanoate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
Module
act_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACLA_086780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACLA_086780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACLA_086780
   00430 Taurine and hypotaurine metabolism
    ACLA_086780
Enzymes [BR:act01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ACLA_086780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Myc_N
Motif
Other DBs
NCBI-GeneID: 4700280
NCBI-ProteinID: XP_001268403
UniProt: A1CUJ0
LinkDB All DBs
AA seq 548 aa AA seqDB search
MVHLAKVHHDEEEPNPIVSRVDSIKLDTVDDDGFYSTVYGTRFAAEQLPQTEMPEKEMPR
EVAYRMIKDELSLDGNPMLKYVLFLWRLISEEEAEKLMTDSFSKNFIDYEEYPQSAEIQN
RCVNMIARLFNAPVSKEEDRPIGTSTIGSSEAIMLGTLAMKRRWQNKRKAEGKDYSRPNI
VMNSAVQVCWEKAARYFDIEERYVYCTADRYVIDPQQAVDLIDENTIGICAILGTTYTGE
YEDVKAINDLLVERDLDVPIHVDAASGGFVAPFINPSLQWDFRLEKVVSINVSGHKYGLV
YPGVGWVVWRSPEFLPKELIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYR
SIMVNITRIADYLAEQLEKLGFIILSQRRGHGLPLVAFRLSPDRKEQYDEFALAHQLRER
GWIIPAYTMAPHSNELKLMRVVVREDFSMNRCDALLSDIRLALRTLSDMDKAMLEKYTQY
VLDPPEREEGEEEEEEEEEVERKTVLIVTRRHVQRHTTKSHQAKHNHPHYKNETHSLQGK
TGKTHGVC
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtccatctcgccaaggtccaccacgacgaagaagagccgaatccgatcgtctcgcgc
gtcgactccatcaagctcgacaccgttgacgatgatggcttctactccaccgtatacggc
acgcggttcgctgccgagcagctgccccagaccgagatgcccgagaaggagatgccccgc
gaggttgcctaccgcatgatcaaggatgagttgagtttggatgggaatccgatgctcaag
tacgttctgttcctgtggcgattgatcagcgaggaagaggccgaaaaactgatgaccgac
tcattcagcaaaaacttcatcgactacgaagaatacccccagtccgctgagatccagaac
cgatgcgtcaacatgatcgcccgcctgttcaacgcccccgtgagcaaggaggaggaccgc
cccatcggcacctcgaccattggctcgtccgaggccatcatgttgggcacgctggcgatg
aagcggcgctggcagaacaagcgcaaggccgagggcaaggactactcgcgccccaacatc
gtcatgaacagcgccgtgcaggtgtgctgggagaaggccgcgcgctacttcgacatcgag
gagcgctacgtttactgcaccgcggaccgctacgtgatcgacccgcagcaggccgtcgac
ctgatcgatgagaacaccatcggcatctgcgccatcctgggcaccacgtataccggcgaa
tacgaagacgtgaaggccatcaacgacctcctggtcgagcgtgacctggacgtccccatc
cacgtcgacgccgccagcggcggcttcgtcgcccccttcatcaaccccagcctgcagtgg
gacttccgtctggaaaaggttgtctcgatcaacgtctcgggccacaagtacgggctggtg
taccccggcgtcggctgggtggtctggcggtcgcccgaattcctccccaaggagctgatc
tttaacatcaactatctgggcgccgaacaggccagtttcaccctcaacttctccaagggc
gcgtcccaggtcatcggccagtactaccagatgatccggctggggaagcgcggataccgc
tccatcatggtcaacatcacgcggatcgctgactacttggccgagcaactggagaaactg
ggtttcatcatcctgagccagcggcgcggccacggactgcccctggtggcgttccgcttg
tcgccggaccgcaaggaacaatatgatgagtttgcgctggcgcaccagctgcgcgaacgg
ggctggatcattcctgcctacacgatggcgccgcacagcaacgagctgaagctgatgcgg
gttgtcgtgcgggaggatttcagcatgaaccggtgtgacgctctgctgtctgatatcagg
ctggccttgcggacgctgagtgatatggacaaggcgatgctggagaaatatacccagtac
gttcttgatccacccgaaagagaagaaggggaagaagaagaagaagaagaagaagaagtg
gagagaaagacagtgctaattgttactcgcagacatgttcagaggcacaccaccaagtct
caccaggccaagcataaccatccccattacaagaatgagacgcattccttgcagggcaag
accgggaagacccatggagtgtgctag

DBGET integrated database retrieval system