KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_02680Help
Entry
C1701_02680       CDS       T05306                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
acta  Actinoalloteichus sp. AHMU CJ021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 3HCDH_N Shikimate_DH ApbA TrkA_N NAD_binding_2 ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C F420_oxidored UDPG_MGDP_dh_N Pyr_redox NAD_binding_8 NAD_binding_10 NAD_binding_7 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AUS81412
UniProt: A0A2I7YPN6
LinkDB All DBs
Position
748017..749039
Genome map
AA seq 340 aa AA seqDB search
MRAAVIDVPGTVRVGEVPDPTPTPDQIVVKVEACGICGTDLHIADGEFPPSPYPLVPGHE
FAGEVVEVGSGVATGIAVGDRVAVDPSLFCGYCTPCRAGHGNLCANWGATGDTVNGAFAE
FVAVPADTAYTLAETTSYADGALVEPLSCAVHGVRTLGVEVGERILVVGTGTMGLLIIQL
LTRAGARVYAVDRNTARLPMAERHGAVATATSIEELDTAPFDAAVDVTGAPPAIEGAFDA
LRRGGRLQIFGVAADTARISLSPFRIYNDEIRIVGSMAVLHSFGAALNLIESGLIDTAGL
VSHTLPLSSFPSALEMVRAGTGLKVQVSPTLLDQDQTTGS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagcggtgattgacgtacccggaaccgtccgtgtgggggaggtgccggatccg
acaccgactcccgaccagatcgtcgtgaaggtcgaagcctgcgggatctgcggcaccgac
ctgcacatcgcggacggtgagttcccgccctcgccctacccgctggtccccggccacgag
ttcgccggcgaggtcgtcgaggtcggttccggcgtggccaccggaatcgcggtcggcgac
cgggtcgccgtcgacccgtccctgttctgcggctactgcaccccctgccgggccgggcac
ggcaacctctgcgccaactggggcgccaccggtgacacggtcaacggcgccttcgccgag
ttcgtggccgtgccggccgacaccgcctacacgctggccgagacgaccagctacgccgac
ggcgcgctcgtcgaaccgctgtcctgcgcggtgcacggcgtgcgcaccctgggcgtcgag
gtcggggaacgcatcctcgtggtcggcaccggcacaatgggcctgctgatcatccagctg
ctcacccgcgccggcgcgcgggtgtacgcggtggaccgcaacaccgcccgcctgccgatg
gccgagcggcacggagccgtggccacggccaccagcatcgaggagctggacaccgctccc
ttcgacgccgccgtggacgtgacgggcgcgccgccggccatcgagggcgccttcgacgcg
ctccgccggggcggccggctccagatcttcggcgtggcggcggacaccgcccggatcagc
ctctccccgttccgcatctacaacgacgagatccgcatcgtcggttcgatggcggtgctg
cacagcttcggcgccgcgctgaacctgatcgagtccggtctgatcgacaccgccggcctg
gtcagccacaccctgccgctgtcgtccttcccgtcggcgctggagatggtgcgcgccggg
accggcctgaaggtgcaggtctcccccacgctgctcgaccaggaccagaccaccggttcc
tga

DBGET integrated database retrieval system