KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_04550Help
Entry
C1701_04550       CDS       T05306                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Pathway
acta03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acta00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    C1701_04550
Enzymes [BR:acta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C1701_04550
DNA repair and recombination proteins [BR:acta03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C1701_04550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AUS77753
UniProt: A0A2I7YDY8
LinkDB All DBs
Position
complement(1166557..1167990)
Genome map
AA seq 477 aa AA seqDB search
MADLDEYRRRRDPRRTPEPVPDHGPLPHGADDVFVVQEHHARRLHWDVRLERNGVLVSWA
VPKGLPAEPGTVRLAVRTEDHPLDYADFEGRIPKGEYGAGEVLIWDRGTYETRKWTDHEV
DVVLHGDRVTGRYVFFGRGGDWMVRRSDPPQDPDRVPVPDDVAPMLATAGTLPSTSEDDQ
WCYEFKWDGARALAEVEGGRLRLRNRRGEDVTATYPELRGLGEQLGSTQVLLDGEIVVLD
QGRPSFALLQRRLHVTGQARTRRLAEEHPATLLVFDLLHLDGRNLFDLPYTRRRALLDEL
APRGPHWQTPPSFSGGGAAVLQVSRERGFEGIVAKHRDSPYRPGRRSPAWTKIKDVRTQE
VVVGGWRPGEGRRSGVLGSLLLGLPGPDGLRFVGSVGSGFSEAELRSLTGTLRELASAKS
PFVGPVPAQRARSALWVEPRLVGEVLFQEWTRDGRLRAPRWRGLRDDKRPAEVTEGA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctggacgagtaccggcgtcggcgggacccgagacggacgcccgagcccgtc
cccgaccacggccccctcccgcacggcgcggacgacgtgttcgtcgtgcaggaacaccac
gcccgacgcctgcactgggatgtccggctcgaacggaacggggtgctcgtctcctgggcg
gtgcccaagggcttgcccgccgaacccggcaccgtccgactcgccgtgcgcaccgaggac
cacccgctcgactacgcggacttcgagggccgcatcccgaagggggagtacggggccggt
gaggtgctgatctgggacaggggcacctacgagacccggaagtggaccgaccacgaggtc
gacgtggtgctgcacggcgaccgggtgacggggcgctacgtcttcttcggtcgaggcggc
gactggatggtgcgacggagcgacccgccccaggaccccgaccgggtcccggtgcccgac
gacgtggcgccgatgctggccaccgccggcaccctgcccagcacctccgaggacgaccag
tggtgctacgagttcaagtgggacggcgcccgggccctcgccgaggtggagggcggtcgg
ctccggttgcgcaaccgtcgaggcgaggacgtcaccgccacctaccccgagctgcggggg
ctcggggagcagctcggctccacccaggtgctgctcgacggcgagatcgtcgtgctcgac
cagggacgcccgagtttcgcgctgctccaacgtcggctccacgtcaccgggcaggccagg
accaggcgcctcgccgaggaacaccccgccaccctcctcgtcttcgacctcctccacctc
gacggccggaacctcttcgacctgccctacacgcggcggcgggcgctgctcgacgagctc
gccccgcgcggaccccactggcagacacccccgtccttctccggagggggcgccgccgtc
ctccaggtgagcagggaacgggggttcgagggcatcgtcgccaagcaccgagactccccg
taccggccgggccggcgctcaccggcctggaccaagatcaaggacgtgcgcacccaggag
gtggtggtcggcggctggcgtccgggggagggccggcggagcggggtgctgggatcgctg
ttgctcggcctccccggccccgacgggctccgcttcgtcggatcggtcggcagcggcttc
tccgaagccgaactgaggagcctcaccggcacgctgcgcgagctggccagcgcgaagtcc
cccttcgtcggaccggtgccggcccagcgggcccggtccgccctctgggtcgaaccccgc
ctggtcggtgaggtgctgttccaggagtggacgcgggacgggcggctccgggccccccgc
tggcgcggactccgggacgacaaacggccagcggaggtgaccgagggtgcctga

DBGET integrated database retrieval system