KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_13950Help
Entry
C1701_13950       CDS       T05306                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Pathway
acta00020  Citrate cycle (TCA cycle)
acta00480  Glutathione metabolism
acta01100  Metabolic pathways
acta01110  Biosynthesis of secondary metabolites
acta01120  Microbial metabolism in diverse environments
acta01130  Biosynthesis of antibiotics
acta01200  Carbon metabolism
acta01210  2-Oxocarboxylic acid metabolism
acta01230  Biosynthesis of amino acids
Module
acta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acta_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:acta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C1701_13950
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C1701_13950
Enzymes [BR:acta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C1701_13950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUS79281
UniProt: A0A2I7YIH5
LinkDB All DBs
Position
3243110..3244333
Genome map
AA seq 407 aa AA seqDB search
MSSKIKVEGKVVELDGDEMTRIIWQFIKDKLVHPYLDVDLEYYDLGIESRDATDDQITVD
AANAINKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIISNIPR
LVPGWTQPIIIGRHAHGDQYKASDFKVPGPGTVTITYTPEGEGEPIELEVANFPEGGGVA
LGMYNYRKSIEDFARASFSYGLQRGYPVYMSTKNTILKAYDGMFKDVFAEIFEKEFKAEF
DAKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMSPD
GRTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLAHRGKLDNTPEVVGFAQTL
EKVVIETVESGKMTKDLALLVGGDTPFQTTEEFLATLDENLARKVAA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagatcaaggtagagggcaaggtcgtcgagctcgacggcgacgagatgacc
aggatcatctggcagttcatcaaggacaagctcgtccacccctacctggacgtcgacctt
gagtactacgacctgggcatcgagagccgggacgccaccgacgaccagatcacggtcgac
gcggccaacgcgatcaacaagcacggggtgggcgtcaagtgcgccaccatcacgccggac
gaggcgcgggtcgaggagttcggcctgaagaagatgtggcggagcccgaacggcaccatc
cgcaacatcctcggtggcgtcgtcttccgcgagccgatcatcatctcgaacatcccccgg
ctggtgccgggctggacgcagccgatcatcatcggccggcacgcccacggcgaccagtac
aaggccagtgacttcaaggtccccggcccgggcaccgtcaccatcacctacaccccggag
ggtgagggcgagccgatcgagctggaggtcgcgaacttcccggagggcggcggcgtcgcc
ctcggcatgtacaactaccggaagtcgatcgaggacttcgctcgcgcgtccttctcctac
ggcctgcagcgcggctacccggtctacatgtcgaccaagaacaccatcctcaaggcctac
gacggcatgttcaaggacgtgttcgccgagatcttcgagaaggagttcaaggccgagttc
gacgccaagggcctcacctacgagcaccgcctcatcgacgacatggtggccgccgccatg
aagtgggagggcggctacgtgtgggcctgcaagaactacgacggtgacgtgcagtccgac
acggtggcgcagggcttcggctccctcggtctgatgacctccgtgctgatgagccccgac
gggcgcaccgtcgaggccgaggccgcccacggcacggtgacccggcactaccggcagcac
cagcagggcaagcccacctccacgaacccgatcgcctcgatcttcgcctggacccggggc
ctggcccaccggggcaagctggacaacacccccgaggtcgtcggcttcgcgcagacgctg
gagaaggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgccctcctg
gtcggcggcgacacgccgttccagaccaccgaggagttcctggcgaccctggacgagaac
ctggccaggaaggtcgccgcctga

DBGET integrated database retrieval system