KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_16110Help
Entry
C1701_16110       CDS       T05306                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Pathway
acta00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:acta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C1701_16110
Enzymes [BR:acta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C1701_16110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AUS79621
UniProt: A0A2I7YJG1
LinkDB All DBs
Position
complement(3716064..3718088)
Genome map
AA seq 674 aa AA seqDB search
MEAVRARLGGFAYGGDYNPEQWSEDVWVEDLRLMREAKVSLVSVGIFSWARVEPRPGQFD
FAWFDRVLDGLAENGIGACLATMTASPPAWLGRLYPETLPVTVDGTRLSHGSRQHYCPSS
PIYRERAAELVRRIGERYGDHPAVALWHINNEYGCHLPACYCDESAVDFRRWLRSRYTDI
DELNTAWYTDFWAQRYTDWDEILPPRAAPFHSNPGQRLDFARFTSDAFLACYRMEADILR
AAAPSVPATTNFISSGASIDAFAWAEEMDVVSYDAYPDPWDRQSQREIAFNSDLMRSLRA
GQPWLLMEQATSGVNWRDRNSPKAPGVMRLDSWQAVAQGADAVMFFQWRASQGGTEKFHA
AMVPHAGENTRIFREVCALGDELARAREVAGSRVVADVALLLDWSSWWALEMDSHPSVDV
RQVESSLAHYAPLFEAGVACDVVHPESDLSGYRLVIAPNLYSVSPQAATNLREYVRGGGH
LAVSFFSGIVDDRDQVYLGGYPGAFRDVLGVWVEEFWPLPENGTVPVRGLGDQDTEVLGT
VWSEQIHLEGAAAVASFAGGELAGSPAITRNEFGSGVAWYLGTRLPEDAMRGLVDGIRAE
AGVAPVLPDLPAGVRAWERVAESGERYLLVLNRGEEPVRIPLPTTGTDVLQPGDPLTEVA
VERRGVAVLRLARD
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgtccgagcacgccttggcggcttcgcctacggcggcgactacaaccccgag
cagtggtcggaagatgtgtgggtcgaggacctccggttgatgcgggaggccaaggtctcc
ctcgtcagcgtcgggatcttctcctgggccagggtcgaaccccgtcccggccagttcgac
ttcgcgtggttcgaccgggtcctcgacgggctcgccgagaacgggatcggcgcctgcctc
gcgaccatgaccgcgtcgccccctgcctggctgggccgtctctacccggagacgctgccc
gtgaccgtcgacggcacccgcctctcccacggttcccgccagcactactgcccctccagc
ccgatctaccgggaacgcgccgccgaactggtgcggcggatcggtgagcgctacggcgac
cacccggccgtcgccctctggcacatcaacaacgagtacggctgccatctgcccgcctgc
tactgcgacgagtcggcggtggacttccggcggtggctgcgcagccgctacaccgacatc
gacgagctgaacaccgcctggtacaccgacttctgggcccagcggtacaccgactgggac
gagatcctgccgccgagggccgctcccttccactccaaccccgggcagcgcctcgacttc
gcgaggttcacctccgacgccttcctggcctgctaccgcatggaggccgacatcctccgc
gcggccgcgccctccgtgccggcgaccaccaacttcatcagctccggcgcctccatcgac
gcgttcgcgtgggcggaggagatggacgtcgtctcctacgacgcctacccggacccgtgg
gaccgccagagccagcgggagatcgccttcaactcggacctgatgcggtcactgcgggcc
ggtcagccctggctgttgatggaacaggccaccagcggcgtgaactggcgggaccggaac
tcgcccaaggccccgggcgtcatgcggctggacagctggcaggccgtggcgcagggcgcc
gacgcggtcatgttcttccagtggcgggcttcccagggcggcaccgagaagttccacgcc
gcgatggtgccgcacgcgggggagaacacccgcatcttccgcgaggtgtgcgccctgggt
gacgaactggccagggcccgggaggtcgccgggagccgggtggtcgccgacgtggcgctg
ctgctggactggtccagctggtgggcgttggagatggactcccacccgagcgtcgacgtc
cggcaggtcgagtccagtctggcgcactacgcaccgctgttcgaggccggcgtggcctgt
gacgtcgtgcacccggagtccgacctcagcgggtaccggctggtgatcgcgcccaacctc
tacagcgtcagcccgcaggccgccacgaacctccgcgagtacgtccggggcggcggccac
ctggcggtgtccttcttctccggcatcgtcgacgaccgcgaccaggtctacctgggcggc
tacccgggagccttccgcgacgtgctgggcgtctgggtcgaggagttctggccgctgccg
gagaacgggacggtcccggtgcggggcctgggagaccaggacacggaggtcctcggcacc
gtctggtccgagcagatccacctggagggcgccgccgccgtcgcgtcgttcgccggcggg
gagctggcggggtccccggcgatcacccgcaacgagttcggctccggggtcgcctggtac
ctcggcacccggctgcccgaggacgccatgcgcggcctcgtcgacggcatccgggccgag
gccggggtggcgccggtgctgcccgacctgccggccggcgtgcgggcctgggagcgtgtc
gcggagagcggtgagcgctacctgctggtgctcaaccggggcgaggagccggtgcggatc
cccctgcccacgaccgggaccgacgtcctccagcccggggacccgctgaccgaggtcgcg
gtggaacggcggggagtcgccgtgctgcgcctcgcccgcgactag

DBGET integrated database retrieval system