KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_21730Help
Entry
C1701_21730       CDS       T05306                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Pathway
acta00250  Alanine, aspartate and glutamate metabolism
acta00410  beta-Alanine metabolism
acta00430  Taurine and hypotaurine metabolism
acta00650  Butanoate metabolism
acta01100  Metabolic pathways
acta01110  Biosynthesis of secondary metabolites
acta01120  Microbial metabolism in diverse environments
acta02024  Quorum sensing
Module
acta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C1701_21730
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C1701_21730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1701_21730
   00430 Taurine and hypotaurine metabolism
    C1701_21730
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C1701_21730
Enzymes [BR:acta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C1701_21730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AUS80519
UniProt: A0A2I7YMS0
LinkDB All DBs
Position
complement(5104626..5106068)
Genome map
AA seq 480 aa AA seqDB search
MARGPLSGDRPDGDDEVSVNPVFTQEPTRVPRHALPHRGLPPRVAYQVVRDELMLDGNAR
LNLATFVTTWMDEEADELIALCSDRNVVDKDEYPRTAELEERCVHMLSRLWNAPDPRRAV
GCSTTGSSEACMLAGLALKRRWQHRRRAAGASTERPNLVMGANVQVCWDKFANYWDVEPR
VVPMSGARFHLSPEEAVARCDDHTIGVVGVLGSTFDGSYEPVEDICRALDELEGRAGLDV
PVHVDAASGGMVAPFCDPDLRWDFRLSRVASINTSGHKYGLVYPGVGWVVWREPSALPED
LVFRVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGVTGYRRVQLYCREVATRLAAAVA
DLGPFRLVSDGSQLPVLTWCLREDVTGYSVFDVAAALRESGWLVPAYTFPPDRTDLSVLR
VVVRNGFTRDLSDLFLADLRRALPRLRRQTGPVRGPEAGGFDHGATRSGAAHPRPRRSPG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtggaccgctctccggcgaccggcccgacggcgacgacgaggtgtcggtgaac
ccggtgttcacccaggagccgacgcgggttccccggcacgccctgccgcaccggggactc
ccgccccgggtggcctaccaggtggtgcgcgacgagctgatgttggacggcaacgcgcgc
ctgaacctggccaccttcgtcacgacctggatggacgaggaggcggacgagctcatcgcg
ttgtgctccgaccgcaacgtggtcgacaaggacgagtacccgaggaccgccgagttggag
gagcggtgcgtccacatgctgtcccggctgtggaacgccccggacccgcgtcgggccgtc
ggatgttcgacgacggggtcgagtgaggcctgcatgctcgccgggctggcgttgaaacgc
cggtggcagcaccgccggcgggcggcgggcgcgtcgacggagcgcccgaacctggtgatg
ggtgccaacgtccaggtctgctgggacaagttcgccaactactgggacgtcgaaccgagg
gtggtgccgatgtcgggcgcccggttccacctgtccccggaggaggcggtggcccgctgc
gacgaccacacgatcggcgtggtcggcgtcctcgggtcgaccttcgacggcagttacgaa
cccgtcgaggacatctgccgggcgttggacgagctggaggggcgcgccggcctcgacgtc
ccggtgcacgtggacgcggcctcgggtggcatggtggcccccttctgcgacccggacctg
cggtgggacttccggttgtcccgggtcgcctcgatcaacacctccggccacaagtacggg
ttggtgtacccgggcgtgggctgggtggtgtggcgggaaccgtcagcgctcccggaggac
ctggtgttccgggtgaactacctgggtggcgacatgcccaccttcgcgttgaacttctcc
cggccgggagcgcaggtcgtggcgcagtactacaacttcctccggctcggcgtgaccggt
taccgccgcgtgcagctgtactgccgggaggtggccacccggctcgcggcagcggtggcg
gacctggggccgttccgcctggtcagcgacggcagccagctgccggtcctcacgtggtgc
ctccgcgaggacgtcacggggtacagcgtgttcgacgtggccgcggcgctgcgggagtcc
ggctggctggtgccggcgtacaccttcccaccggatcgcaccgacctgtccgtgctccgg
gtcgtggtgcgcaacggtttcaccagggacctctcggacctcttcctggccgatctccgg
cgggcgttgcctcggctgcgccgtcagaccggtccggtgcgggggccggaggccggcggt
ttcgaccacggcgcgacccggtccggtgccgcccaccctcggcctcggcgttcgccgggc
tga

DBGET integrated database retrieval system