KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_22205Help
Entry
C1701_22205       CDS       T05306                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Pathway
acta00250  Alanine, aspartate and glutamate metabolism
acta00410  beta-Alanine metabolism
acta00640  Propanoate metabolism
acta00650  Butanoate metabolism
acta01100  Metabolic pathways
acta01120  Microbial metabolism in diverse environments
Module
acta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C1701_22205
   00650 Butanoate metabolism
    C1701_22205
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C1701_22205
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1701_22205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acta01007]
    C1701_22205
Enzymes [BR:acta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C1701_22205
Amino acid related enzymes [BR:acta01007]
 Aminotransferase (transaminase)
  Class III
   C1701_22205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AUS80599
UniProt: A0A2I7YMZ2
LinkDB All DBs
Position
5222964..5224220
Genome map
AA seq 418 aa AA seqDB search
MAQLSPQLKQATPVRAVRGSGVYLYDAEDRTYLDFTSGIGVVNTGHCHPRVVEAAQRQVG
KLIHGQYTTVLHEPLLELTERLGEVLPAGLDSVFYLNSGSEAVEASVRLARHVTGRQNIV
VFQGGFHGRTMGAAALTTAGTKFRAGLGPLMPGAAVSPYPFAYRYGWSEEQAVEFALREL
DYLLRTVSAPADTAAFMVEPVLGEGGYVPAPAGFLAGLRQRADEHGVLLILDEVQTGFGR
TGRFWGHEHHGGVRADILITAKGLASGFPLSAIAAPAELMSQAWPGSQGGTYGGNAVACA
AAIATLEVIRSEALVENAEEMGRRLLEGTRKIAVDHATIGDVRGLGLMIGVEFTGADGEP
RPDLAQRAHKEAADRGLLLLTCGAHGNTVRMIPPLVVNAEQVDDALTRWQEAVQAATS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctctctcctcagctcaagcaggccactccggtgcgagccgtccgaggttcc
ggggtgtacctctacgacgcggaggaccggacctacctggacttcacctccggaatcggc
gttgtcaacaccgggcactgccacccccgggtggtcgaggccgcgcagcgccaggtcggg
aagctcatccacggccagtacacgacggtgctgcacgaaccgctgctcgaactcaccgaa
cggctcggcgaggtcctccctgcggggctggactcggtcttctacctcaactccgggagc
gaggccgtcgaggcctcggtacgcctggcacggcacgtgacgggccggcagaacatcgtg
gtcttccagggcgggttccacgggaggacgatgggagcggcggccctcacgaccgccggg
accaagttccgcgccggcctgggcccgctgatgccgggggcggccgtctcgccctacccc
ttcgcctaccgctacggctggtcggaggagcaggcggtggagttcgccctccgcgagctg
gactacctgctccggaccgtcagcgcacccgcggacaccgccgccttcatggtcgaaccg
gtcctcggcgaaggcggctacgtgccggccccggcggggttcctggccggactgcgccag
cgggccgacgaacacggtgtcctgctcatcctcgacgaggtccagacgggcttcggccgc
accggccggttctggggccacgagcaccacggcggggtccgcgcggacatcctcatcacc
gcgaaaggcctcgccagcggcttcccgctctcggccatcgccgcgccggcggaactgatg
agccaggcgtggccgggctcgcaggggggcacctacggcggcaacgcggtcgcctgcgcc
gccgcgatcgccaccctggaggtgatccggagcgaggccctcgtcgagaacgccgaggag
atgggacgccggctgctggaggggaccaggaagatcgcggtcgaccacgccaccatcggc
gacgtccggggcctcggcctcatgatcggtgtcgagttcaccggcgccgacggcgagccc
cggcccgacctggcgcagcgggcgcacaaggaggccgcggaccggggactgctcctcctc
acctgcggcgcccacggcaacacggtacggatgatcccgccgctggtcgtcaacgccgag
caggtggacgacgccctcacccggtggcaggaggcggtccaggcggccacctcctga

DBGET integrated database retrieval system