KEGG   Actinomyces sp. Chiba101: CHIBA101_0334Help
Entry
CHIBA101_0334     CDS       T05279                                 

Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00511  Other glycan degradation
actc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:actc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CHIBA101_0334
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CHIBA101_0334
Enzymes [BR:actc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CHIBA101_0334
Bacterial toxins [BR:actc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CHIBA101_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CW_binding_1 BNR_2 BNR_3 BNR DUF1999
Motif
Other DBs
NCBI-ProteinID: BAW92205
UniProt: A0A1Q2TKC4
LinkDB All DBs
Position
397053..399272
Genome map
AA seq 739 aa AA seqDB search
MRTHHPRIPAILGAGAIALTGLTIAPTAQAAKTADGLMDVVITQAADANGGVYAVGSTLT
FDIKVTNLSAEARSFEVAKTNLGGRVTACKWRNIAAKATKTDCMGYATHTITQADLDAGS
FTPEISYTVRAPEYKGDALNTPETVRGAAVPIKAAPPGQDAPKGPQEPEEEKGDFPKAEP
APLPDASVSLPASMSDGTAVATGTATDNVRIPAITTAPNGDLLVAYDVRPTDNGNKGGDS
PNPNHIVQRRSTDGGKTWGAPTYIHKGIETGAKEGYSDPSYVVDSATGAIFNFHVKSFDA
GWPTSRAGSDPADRGVIQAEVSTSTDNGHTWTHRVITPDITNDPSWIARFAASGQGIQIQ
NGEHKGRLVQQFTIKLANGTIRAVSVYSDDHGATWKAGTPAGTGMDENKVVELSDGRLMM
NSRVSDGSGFRKVATSTDGGQTWSEPVSDKNLPDSVDNAQIIRAFPNAAPGTERAKVLLL
SHSPNPKAWSRDRGTISLSCDDGATWTGKVFRAERVGYTTLAVQSDGSLGVLSEDGNDRQ
IAYRNFSLAWLGSDCPALKDAPSPEPKPEEPPAPAPKAGWEKDGGNWRYRNADGGLATGW
LKDGASWYYLRSDGTMATGWVKDGGAWYALKDDGAMRTGWFKDGGAWYLLRDNGAMATGW
AKDGGKWYHFADSGAMTTGWIRLAGTWYHLGASGAMTTGWLQDGGSWYYLRANGAMATGW
VTVGPSRYYMDPSTGVWRG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcatcacccccgtatcccagcgatcctgggagccggtgccatcgcgctcacc
ggactcaccatcgccccgacggcgcaggcggccaagaccgctgatggcctcatggacgtc
gtcatcacccaggccgcagatgccaacggcggcgtctacgccgtcggaagcactcttacc
ttcgacatcaaggtcactaacctgagtgccgaggcccgctccttcgaggtcgccaagacc
aatctcggaggtcgggtcaccgcctgcaagtggcgcaacatcgccgctaaggccaccaag
accgactgcatgggctacgccacccacaccatcacccaggccgatctcgatgcgggctcc
ttcaccccggagatctcctacactgtccgcgctcccgagtacaagggtgatgccctcaat
accccggagaccgtccgcggcgccgccgtgccgatcaaggcggcccctcccggacaggat
gcgcccaagggcccgcaggagcccgaggaggagaagggcgacttccccaaggccgagccc
gcgcccctcccggacgcctcggtgtcgctgcccgcctcgatgagcgatggcaccgcggtg
gccacgggcaccgccacggataatgtccgcatccccgcgatcaccaccgcgcccaacgga
gacctcctcgtggcctatgacgtccggcccacggacaatggcaataagggtggcgactca
cccaacccgaaccacatcgtccagcgccgttccaccgacggcggtaagacctggggtgcg
cccacctacatccacaagggcattgagaccggggccaaggagggttactcagacccctcc
tacgtcgtcgactcggccacgggcgcgatcttcaacttccacgtgaagtccttcgacgcc
ggctggcccacatccagggcaggctctgaccccgcagaccgcggcgtcatccaggccgag
gtctccacctccacggacaacggccacacctggacccaccgcgtcatcaccccggacatc
acgaacgatccctcatggatcgcccgcttcgccgcctccggccagggcattcagatccag
aacggcgagcacaaggggcgcctcgtccagcagttcaccatcaagctcgccaatggaact
atccgggccgtctccgtctactccgacgaccacggcgccacctggaaggccggaaccccg
gccggcaccggaatggatgagaacaaggtcgtcgagctctccgacggtcggctcatgatg
aactcgcgcgtttccgatggaagcggcttccgcaaggtggccacctccaccgacggcggt
cagacatggtcagagccggtctcggacaagaacctcccggactcggtggataacgcccag
atcatccgcgccttccccaatgccgccccgggcacggagcgcgccaaggtcctcctcctc
agccactcgccgaaccccaaggcgtggtcccgcgaccgtggcacgatctcactgtcctgc
gacgacggtgctacgtggacgggcaaggtcttccgcgccgagcgtgtcggctacacgacg
ctggccgtgcagtccgacggctcgctgggagtcctcagcgaggatgggaacgaccggcag
atcgcctaccgcaacttctccctggcctggctgggcagcgactgccccgccctcaaggac
gccccgagcccggagccgaagcccgaggagccccctgcccccgccccgaaggctggttgg
gagaaggatggtggtaattggcgttaccgcaatgctgatggcggtctggccaccggttgg
ctcaaagatggtgcgtcctggtactacctgcgctccgatgggacgatggccacggggtgg
gtcaaggacggcggtgcctggtacgccttgaaggacgatggcgcgatgcgcaccggctgg
ttcaaggatggcggtgcctggtatctgctgcgggacaacggtgccatggccaccggttgg
gccaaggatggtgggaagtggtaccacttcgccgacagtggggcgatgaccactggttgg
atccgcctggccggtacctggtaccacttgggcgccagtggggctatgaccacggggtgg
ctccaggacggtggctcctggtactacctgcgggccaatggtgccatggccacgggttgg
gtgacggttggtccgagccgttactacatggatccctccacgggggtctggcggggctga

DBGET integrated database retrieval system