KEGG   Actinomyces sp. Chiba101: CHIBA101_0517Help
Entry
CHIBA101_0517     CDS       T05279                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00564  Glycerophospholipid metabolism
actc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:actc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHIBA101_0517
Enzymes [BR:actc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CHIBA101_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAW92384
UniProt: A0A1Q2TLB4
LinkDB All DBs
Position
complement(605473..607245)
Genome map
AA seq 590 aa AA seqDB search
MSSPAPAPAPLRSTALNREQRAEALAALSANGPTDEPLDVLVIGGGVTGAGIAVDAASRG
LRTGIVEMGDWASGTSSWSSKLVHGGLRYLYQANFALVHEALTERGRLLTSNAPHLVKAQ
PFLWPLKHHYERTYSAVGVGMYDALAVAGARGHRTVPIQKHLGKKGTAALAPALDTSHLA
GAIRFYDARVDDSRLVIDLVRTAVGLGAHAANRTRVTGFLKDGEGRVTGVTATDLASGEE
IEIRATRTINATGVWTEEVQDMATTEGGLKVLASKGIHIVVPKTAIDAETGIFLRTEKSV
LFIIPWPEYWVIGTTDTPWAEDVAKPVATSADIDYVLEHANSVLTRPIRREDIIGVYAGL
RPLLQPRLKPGAKAASTKVSREHTVTRVAPGLTAIAGGKLTTYRVMGVDAVDHALGEALA
HAHPSRTENLPLVGAEGYEELAGRAAQLAAERDWTLARITHLLDRYGDETADILELIDAD
AEAENSQRLGEPLAGAPTYLRAEVSWAVTHEGAEHLEDVLLHRVRLDVSHRDRGLSAAEE
ILGIMAPLLRWSDKDAAAELASYAERVEQIAAAEAETTDAEAVAKVTRPI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcccagcccccgcacccgcaccactacgatccacagccctcaaccgggagcag
cgcgccgaggcgctcgccgccctgtccgcgaacggccccaccgacgagcccctcgacgtc
ctggtcatcggaggcggcgtcacaggcgccgggatcgccgtcgacgccgcctcccgcggc
ctgcgcaccggcatcgtcgagatgggcgactgggcctccggcacgtcgtcgtggtcctcc
aagctcgtccacgggggcctgcgctacctctaccaggcgaacttcgccctcgtccacgag
gccctcaccgagcgcggccgcctcctgacctccaacgcgccccacctcgtcaaggcccag
cccttcctgtggccgctcaagcaccactacgagcgcacctactccgccgtcggcgtgggc
atgtacgacgccctggccgtcgccggcgcccgcgggcacaggaccgtgcccatccagaag
cacctgggcaagaagggcaccgcagccctggcccccgcgctggacaccagccacctggcc
ggcgccatccgcttctacgacgcccgagtggacgactcgcgcctggtcatcgacctcgtg
cgcaccgccgtcggcctgggggcccacgccgccaaccgcacccgcgtcaccggcttcctc
aaggacggcgagggccgcgtcaccggcgtgaccgccacggacctcgcctccggcgaggag
atcgagatccgcgcgacccgcaccatcaacgccaccggcgtgtggaccgaggaggtccag
gacatggccaccaccgagggcggcctcaaggtgctggcgtccaagggcatccacatcgtc
gtgcccaagaccgccatcgacgccgagaccggcatcttcctgcgcaccgagaagtccgtg
ctcttcatcatcccgtggcccgagtactgggtcatcggcaccacggacaccccctgggcc
gaggacgtcgccaagcccgtggccaccagcgctgacatcgattacgtcctcgagcacgcg
aactccgtgctcacccgcccgatccgccgcgaggacatcatcggcgtctacgcgggcctg
cgcccgctgctccagccccgcctcaagcccggcgccaaggcggcctccacgaaggtctcc
cgcgagcacaccgtcacccgcgtggcccccggcctgaccgccatcgccggcggcaagctg
accacctaccgcgtcatgggcgtcgacgccgtcgaccacgccctgggcgaggccctcgcc
cacgcccaccccagccgcaccgagaacctgccgctcgtgggcgccgagggctacgaggag
ctggccggccgcgccgcccagctcgcggcggagcgcgactggacgctggcgcgcatcacc
cacctcctggaccgctacggggacgagacggccgacatcctggagctcatcgacgccgac
gccgaggccgagaactcccagcgcctgggggagcccctggccggggcccccacctacctg
cgcgccgaggtctcctgggccgtcacccacgagggcgccgagcacctcgaggacgtcctg
ctgcaccgcgtgcgcctggacgtctcccaccgcgaccgcggcctgtccgccgccgaggag
atcctggggatcatggccccgctcctccgttggtctgacaaggacgccgctgccgagcta
gcctcctacgccgagagggtcgagcagatcgccgccgccgaggccgagacgaccgacgcc
gaagcggtcgccaaggtcacccggcccatctga

DBGET integrated database retrieval system