KEGG   Actinomyces sp. Chiba101: CHIBA101_0626Help
Entry
CHIBA101_0626     CDS       T05279                                 

Definition
(GenBank) hypothetical protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00010  Glycolysis / Gluconeogenesis
actc00520  Amino sugar and nucleotide sugar metabolism
actc01100  Metabolic pathways
actc01110  Biosynthesis of secondary metabolites
actc01120  Microbial metabolism in diverse environments
actc01130  Biosynthesis of antibiotics
actc01200  Carbon metabolism
Module
actc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
actc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:actc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHIBA101_0626
   00520 Amino sugar and nucleotide sugar metabolism
    CHIBA101_0626
Enzymes [BR:actc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CHIBA101_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAW92492
UniProt: A0A1Q2TLM7
LinkDB All DBs
Position
complement(713456..714196)
Genome map
AA seq 246 aa AA seqDB search
MSVDCGGGGIKASVLDAEGTICSRAVRTPTPYPLPPLKLVETIAGLAEQLPRADRVTVGM
PGMIRHGVVVATPHYITKDGPRSKVLPELAEAWHRFDMGSAIADRLGLPSLILNDAEVAG
AGVVTGHGLEMIVTLGTGLGNAVFDNGVLAPHVEVSQGPVRWGLTYDDYIGEHERLRLGD
AHWSRRVRRVVDGLRPMYLWDRLYLGGGNSRRITALQLTRMGDDVVVVPNEAGMTGGARC
WTMARP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgtcgactgcgggggcggcggcatcaaggcctccgtcctcgacgccgaggggacg
atctgctcgcgcgccgtgcgcacgcccaccccctacccgctgccaccgctgaagctggtc
gagacgatcgccggcctcgccgagcagttgccccgggccgatcgggtcaccgtggggatg
ccggggatgatccgccacggcgtcgtggtcgccaccccccactacatcacgaaggacggc
ccgcgctccaaggtgctcccagagctggccgaggcctggcaccggttcgacatgggctcg
gccatcgccgaccgcctcggcctgccctcgctcatcctcaatgacgccgaggtcgccggc
gccggggtcgtcacggggcacggcctggagatgatcgtgaccctgggcaccggactgggc
aacgcggtcttcgacaacggggtcctggccccgcatgtcgaggtctcccaggggcccgtc
cgctggggattgacctacgacgactacatcggcgagcacgagcgcctccgcctgggcgac
gcgcactggtcccgcagggtgcgccgcgtcgtcgacgggctgcgccccatgtacctgtgg
gaccgcctctacctcgggggcggcaattcgaggaggatcacggcgctccagctgacccgc
atgggcgacgacgtcgtcgtggtgcccaatgaggcggggatgaccggcggggcgcgctgc
tggaccatggctcgtccctag

DBGET integrated database retrieval system