KEGG   Actinomyces sp. Chiba101: CHIBA101_1095Help
Entry
CHIBA101_1095     CDS       T05279                                 

Definition
(GenBank) PASTA domain protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
actc  Actinomyces sp. Chiba101
Brite
KEGG Orthology (KO) [BR:actc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:actc01001]
    CHIBA101_1095
Enzymes [BR:actc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CHIBA101_1095
Protein kinases [BR:actc01001]
 Serine/threonine kinases: Other
  Bacterial family
   CHIBA101_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kdo Kinase-like
Motif
Other DBs
NCBI-ProteinID: BAW92960
UniProt: A0A1Q2TMN1
LinkDB All DBs
Position
complement(1256142..1258238)
Genome map
AA seq 698 aa AA seqDB search
MSHDPLTGRIVDSRYEVGQRVARGGMATVYKAYDRRLERDVALKLMHPHLADSPDFVARF
RREARAAARLSNPGVVAVYDQGAIDGVAYIIMEYVPGPTLRDRIASGPLTVAEALEMTSH
VLRPLGAAHRAGLMHRDIKPENVLLPADGSVPKVADFGLARAVTEATQTSTGNILGTVAY
LAPELITSGASTPRADVYSVGVMLFELLTGEQPFSADTPIQIAFRNVHEDIPAPSTRADG
IPVAIDRLVAAMTARDPQERLANADDALRAVREAAEAVVEDAGPASPAGASGAAEGTSAD
GPGSARSAGSPGSADGAGIPIGAASPAGASGPLSAGVTASAATPAESSLTARLPSNPLDP
GAVTPSAGMRTVSLPIGSISSATGEGADGAEDPDARAAGLLGRRLLIAGGALAVLGAVGG
TGAWYFVSGPGRRVRVPRIEGLSAEEASAAVSGAELVWAEPTTVYSDSVPAGTVISATPA
GGTSVTVGARIQSVVSLGIEQKTVPDVVGKTEHDAQTAIIDAGLTVGQTSREHSSSVATG
MVISTDPAAGQSLDKGAVVNITISKGRASATVPDVVGKTEEEARKALESAGLEMSATRAN
DKSVKEGRVISQSPKKGASGVYKGDAVALVISQGPKMIAVPDVTGKSESEAKKALKDAGF
EVEVDKAWTGHVFGEVDYTRPAKGEQAAEGSKVVVRIK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccacgaccccctgactggccggatcgtcgactctcgctacgaggtcggccagcgc
gtggcgcgcggtggcatggcgacggtctacaaggcctacgaccgccgcctcgagcgcgat
gtcgccctcaagctcatgcacccccacctggcggactcccccgacttcgtcgcccgcttc
cgccgcgaggccagggccgccgcgaggctgtccaatcccggcgtcgtcgccgtctacgac
cagggcgcgatcgacggcgtcgcctacatcatcatggagtacgtgcccggccccaccctg
cgggaccgcatcgcctcgggccccctgacggtggccgaggcgctggagatgaccagccat
gtgctccggccgctgggcgccgcccaccgcgccgggctcatgcaccgggacatcaagccg
gagaacgtcctgctgcctgccgatggctccgtgccgaaggtcgccgacttcggcctggcc
cgggcggtcaccgaggccacgcagacctccacgggcaacatcctggggacggtggcctac
ctcgcccccgagctcatcacctcgggtgcctccacaccgcgcgccgacgtctactcggtg
ggggtcatgctcttcgagctgctcaccggcgagcagccgttcagcgccgacaccccgatc
cagatcgccttccgcaacgtccacgaggatatccccgcgccctcgacgcgcgccgacggg
atcccggtggccattgaccggctagtggccgcgatgaccgcgagggacccgcaggagcgg
ctcgccaacgccgacgacgcgctgcgcgcggtcagggaggcggcagaggccgtcgtcgag
gacgccgggcccgcctccccggcgggcgcgagcggcgctgccgaggggaccagcgccgat
ggccccggcagcgcgcggagcgccgggagccccggcagcgccgacggcgcggggatcccg
atcggcgcggcgagcccggccggcgcctccggcccgctcagcgcgggagtcaccgccagc
gcggccacgcccgcggagtcctccctgaccgcccgtctgccctccaacccccttgatccg
ggcgccgtcacgcccagcgcggggatgcgcaccgtctccctgccgatcggctcgatctcg
agcgccaccggcgagggcgccgacggcgcggaggatcccgatgcgcgcgcggcaggcctc
ctcgggcgccgcctcctcatcgcgggcggcgcgctcgccgtcctcggcgcggtgggcggc
acgggcgcctggtacttcgtctccggccccgggcgccgggtccgggtcccccggatcgag
ggcctgtccgcggaggaggccagtgccgccgtctccggggcggagctggtgtgggccgag
ccgaccacggtctactccgactccgtcccggccggcacggtcatctcggccacaccggcg
ggcggcacctccgtgaccgtgggggcgcgcatccagagcgtcgtctcgctcggtatcgag
cagaagaccgttccggatgtcgtcggcaagaccgagcacgacgcccagacggccatcatc
gacgccggcctgacggtgggccagacctcccgggagcactcctcctccgtggccaccggc
atggtgatctccaccgatccggcggcgggccagtccctggacaagggagcggtcgtcaac
atcacgatctccaaggggcgcgcctcggccacggtgcccgatgtcgtcggcaagaccgag
gaggaggcccgcaaggcgctcgagagcgccggcctggagatgagcgccacaagggccaat
gacaagtcggtcaaggagggccgtgtcatctcgcagtcgccgaagaagggcgccagtggc
gtctacaagggcgatgcggtggcgctggtcatctcgcagggtccgaagatgatcgccgtc
cccgatgtgacgggcaagtcggagagcgaggcgaagaaggcgctcaaggacgccggcttc
gaggtggaggtggacaaggcctggaccggacacgtcttcggcgaggtcgactacaccagg
cccgccaagggcgagcaggccgccgagggctccaaggtggtcgtgcgcatcaagtga

DBGET integrated database retrieval system