KEGG   Actinomyces sp. Chiba101: CHIBA101_1822Help
Entry
CHIBA101_1822     CDS       T05279                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00010  Glycolysis / Gluconeogenesis
actc00030  Pentose phosphate pathway
actc00051  Fructose and mannose metabolism
actc00052  Galactose metabolism
actc00680  Methane metabolism
actc01100  Metabolic pathways
actc01110  Biosynthesis of secondary metabolites
actc01120  Microbial metabolism in diverse environments
actc01130  Biosynthesis of antibiotics
actc01200  Carbon metabolism
actc01230  Biosynthesis of amino acids
actc03018  RNA degradation
Module
actc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:actc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHIBA101_1822
   00030 Pentose phosphate pathway
    CHIBA101_1822
   00051 Fructose and mannose metabolism
    CHIBA101_1822
   00052 Galactose metabolism
    CHIBA101_1822
  09102 Energy metabolism
   00680 Methane metabolism
    CHIBA101_1822
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CHIBA101_1822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:actc01009]
    CHIBA101_1822
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:actc03019]
    CHIBA101_1822
Enzymes [BR:actc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHIBA101_1822
Protein phosphatases and associated proteins [BR:actc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHIBA101_1822
Messenger RNA biogenesis [BR:actc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CHIBA101_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: BAW93655
UniProt: A0A1Q2TPF9
LinkDB All DBs
Position
2159546..2161948
Genome map
AA seq 800 aa AA seqDB search
MTAAGNTAPHPPSTASQEAVIDAVASVACDPTGGTAPTGPAGEPIRVGVLTSGGDAQGMN
AAVRAAVRTLLRLGARPYAVMEGWAGAVAGGEGIRPLEWDSVGAILHRGGTIIGTARSAE
FRERSGQLDAAANLLEHGIDRLIVIGGDGSLTGTNEFRKNWPGLVAELAETGRITARTAQ
AHPALMVAGIVGSIDNDLVGADMTIGTDSALHRILEAIDDISSTAASHQRTFVVEVMGRH
CGYLALMAAVAGGCDYVLVPEIPPAEGWEEDMCAKLAKGRRAGRRESMVIVAEGATDRSG
NRITADDVKRVLSERLGEDARVTILGHVQRGGKPSAYDRWMSTLLGCQAAREVLQASPET
VPVIVVERHNRIRSVPMMEQVEATRAVKDLVAAGDWEGAVAARGRSFGEMLRIFETMSTP
PEPTAAGAAPSRRVAIIHAGGLAPGMNTAARAAVRLGLDHGFTMLGVAGGFPGLLDGEVR
ELSWDDVEGWVGDGGAELGTRREVPEVEQLYALGRAIEKHEIDALLVIGGYNAYLAAHRL
VTEKGRYPAFQIPILCVPASIDNNLPGSELSIGTDTALNATISALDSIKQSAAASHRCFV
AEVMGRKCGYLSFMSGLATGAEGVYLHEGGIGLARLAEDSRRMVEAFKNGRKLHLLIRNE
RASEYYTTDVLAKIFAAEGVGLYDVREAVIGHLQQGGDPTAFDRLMATKLVAHALGLLAD
QLERGTDHSSYVGLTGGRITHRRLERMEDDLDMTNRRPRHQWWLGMRPALDLVSSDLGPL
SMADVPDFGEAVDAAATAED
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcaggcaacaccgctccgcacccgccgtccaccgcctcccaggaggcggtg
atcgacgccgtcgcctccgtggcctgcgatccgaccggtggcacggcgcccaccggcccc
gccggggagccgatcagggtcggggtgctcacctcggggggcgacgcccagggcatgaac
gccgcggtgcgcgccgccgtgcgcacactgctgcgcctgggcgcccggccctacgccgtc
atggagggatgggccggggccgtcgccggcggcgagggcatccgccccctggagtgggac
tccgtgggcgcgatcctccaccggggaggaacgatcatcggcaccgcccgctccgcggag
ttccgcgagcgctccgggcagctcgacgccgctgccaacctcctggagcacggcatcgac
cggctcatcgtcatcggtggggacggctccctgaccggcaccaacgagttccggaagaac
tggccgggcctggtggccgagctcgccgagaccgggcgcatcaccgcccggaccgcccag
gcgcatccggcgctcatggtggcggggatcgtcggctcgatcgacaacgacctcgtcggc
gcggacatgacgatcggcaccgactcggccctgcaccgcatcctggaggccatcgacgac
atctcctccaccgccgcctcccaccagcgcaccttcgtggtggaggtcatgggccgccac
tgcggctacctggcgctgatggcggcggtggccggcggctgcgactacgtgctcgtcccc
gagatcccgcctgccgagggctgggaggaggacatgtgcgccaagctcgccaagggccga
cgggcggggcggcgcgagtccatggtcatcgtcgccgagggcgccactgaccgctccggc
aatcggatcacggccgacgacgtcaagcgggtcctgtccgagcgcctcggcgaggacgcc
cgggtgacgatcctcgggcacgtccagcggggcggcaagcccagtgcctacgaccgctgg
atgtccaccctgctgggatgccaggcggcgcgcgaggtccttcaggcctccccggagacg
gtgccggtgatcgtggtcgagcggcacaaccgcatccgctccgtgccgatgatggagcag
gtcgaggccacgcgcgcggtcaaggacctggtggcggccggcgactgggagggcgccgtg
gccgcccgggggcgcagtttcggcgagatgctgcggatcttcgagacgatgtccactccc
cccgagcccaccgccgccggggccgcccccagcaggagggtggccatcatccatgccggc
ggactcgcgccgggcatgaacacggcggcccgcgccgcggtccgcctgggcctggaccac
ggcttcaccatgctgggcgtggcgggcggattcccgggccttctcgacggcgaggtgcgc
gagctcagctgggacgacgtcgagggctgggtcggcgacggcggggccgagctcggcacg
cgccgggaggtccccgaggtcgagcagctctacgccctgggccgggccatcgagaagcac
gagatcgacgccctgctcgtcatcggcggctacaacgcctacctggccgcgcaccgcctg
gtaacggagaagggccgctaccccgcgttccagatccccatcctgtgcgtcccggcgtcg
atcgacaacaacctgcccggctccgagctgtcgatcggcacggacacggcgctcaacgcg
acgatcagcgccctggactcgatcaagcaatcggcggcggcctcgcaccgctgcttcgtg
gccgaggtgatgggccgcaagtgcgggtacctgtccttcatgagcggcctggccacgggc
gccgagggcgtctacctccacgagggcggcatcgggctggcgcgtctggcggaggactcc
aggcggatggtggaggccttcaagaacgggcggaagctccacctgctcatccgcaatgag
cgggccagcgagtactacaccacggatgtgctggccaagatcttcgccgccgagggcgtg
ggcctgtacgacgtgcgcgaggccgtcatcgggcacctccagcagggcggggaccccacg
gccttcgaccgcctcatggccaccaagctcgtcgcgcacgccctgggtctgctcgccgac
cagctcgagaggggcacggaccactccagctacgtgggcctgaccggcgggcgcatcacc
caccgccgcctggagcgcatggaggatgacctggacatgaccaaccgccggccccgccat
cagtggtggctggggatgcgcccggccctggacctggtctcctcggaccttggcccgctg
tccatggccgatgtccccgacttcggcgaggccgtggacgccgcggccaccgccgaggac
tga

DBGET integrated database retrieval system