KEGG   Actinomyces sp. Chiba101: CHIBA101_2414Help
Entry
CHIBA101_2414     CDS       T05279                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00473  D-Alanine metabolism
actc00550  Peptidoglycan biosynthesis
actc01100  Metabolic pathways
actc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:actc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHIBA101_2414
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CHIBA101_2414
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CHIBA101_2414
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:actc01011]
    CHIBA101_2414
Enzymes [BR:actc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CHIBA101_2414
Peptidoglycan biosynthesis and degradation proteins [BR:actc01011]
 Precursor biosynthesis
  Amino acid ligase
   CHIBA101_2414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N RimK ATP-grasp_4 ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST TTL ATPgrasp_YheCD B12-binding GARS_A
Motif
Other DBs
NCBI-ProteinID: BAW94235
UniProt: A0A1Q2TR53
LinkDB All DBs
Position
2868231..2869112
Genome map
AA seq 293 aa AA seqDB search
MSQRSGNRVAQVLRHLGHSVIVLDVDARMISSLRAFGPDVVWPLVHGGHGEDGGLQNVLI
GLELPYVGTHSDGCQRASFKPTAKATARAGGVLTPDSLTLPKDYFAQMGAQDVLGMVTDH
LGLPVVVKPNQGGSGLGVSLASDADQLRSAMVGCFAYDERALIEKYVAGTEVAVSVVDTG
SGPRALPPVEVSSEGAYDFDARYNPGRSEYFVPARLSEAAIERLKETAVIVHTTLGLGHV
SRTDLILDEAGTPWFIDVNVTPGMTETSLLPLAAEADGDLPSLYDALVHAPLL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccagcgctccgggaatcgcgtcgctcaagtgcttcgccacctcggtcactccgtc
atcgtcctcgatgtcgatgcccgaatgatctcctcactgcgagccttcggcccggacgtt
gtatggccgttggttcacggcggacacggagaggacggtgggcttcagaacgtcctcatc
ggcctcgagctgccctacgtcggtacgcattcagatggatgccagcgggcatccttcaag
ccaacggccaaggcgaccgcacgcgccgggggcgtcctcacccctgattccctcactctt
ccgaaggactatttcgctcagatgggggcacaggatgttctcggcatggtcactgatcac
ctcgggcttccggttgtggtgaagccgaaccagggagggtcgggcctcggcgtatccctc
gcatccgatgctgatcagctccgctcagccatggtgggctgcttcgcctacgacgagcgc
gctctcattgagaagtatgtcgccggcaccgaggttgcggtgtccgtcgtcgatacgggc
tcgggtccacgtgcactccctccagtcgaggtctcgtccgagggggcctacgacttcgac
gcacgatacaacccgggccgatccgagtacttcgtcccggcgaggctctcggaggccgcg
atcgaacggctcaaggagaccgctgtcatcgtccacacgacattggggctcggccatgtc
tccagaaccgatctcatcctcgatgaggccggcacgccctggttcatcgatgtcaatgtg
acaccggggatgaccgagacgagcctcctcccactggccgctgaggccgacggcgatctt
ccgagcctctacgacgccctcgtccacgccccactgctctag

DBGET integrated database retrieval system