KEGG   Actinoalloteichus sp. GBA129-24: UA75_07350Help
Entry
UA75_07350        CDS       T04619                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UA75_07350
Enzymes [BR:acti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     UA75_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 DUF4350 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: APU19489
UniProt: A0A1L7F3W9
LinkDB All DBs
Position
1624524..1626512
Genome map
AA seq 662 aa AA seqDB search
MSDIADVTRGRLVFGGDYNPEQWPREVWREDVELMRRAGVNLVTVGVFSWARLEPTPGAR
DFGWLDEVLDLLHAGGIAVDLATPTASPPPWLGHRHPETLPVDADGRRLLYGSRNQFCPS
SPIYRRHALSLATDLAERYGGHPALAMWHVDNELCEVCHCDVSAAHFRHWLRSRYGDDLA
ALNEAWHTVFWSQRYSDWAEIMPPRRAPYLINPAQQLDFRRFSSAALLECFEVQRDVLRA
ATPDIPITTNFLGLDAPLDYRALAEREDVVSHDWYPDPTNPAAHEMSGLGFDLMRSLAGG
PWFLMEGATSAVNWRRRNAAKAPGQLRAESLHAVARGADAVCFFQWRASRAGAEKYHSGM
VPHAGPDSRIFREVCELGAELAELHEVVDAEVECEAALVLDWDSWWAVRLDAHPTADIDV
LGRLRGFHAALTRLGVAVDVVAPDADLSAYRLVIAPSLYLVTDDAAANLTSFVARGGTLV
LGYFSGIVDEHDHIRLGGYPAPFREALGLRIEEFDPLPEGETVRCSSTLLGGFEARDWLE
ELRPEGAEVVAEVAEGRRAGRPVVLRHEFGTGTAWYVATEPDPTALAALTRQVCTDAGVT
GVLDGLPAGVTATRRGRVLFVINHGPDPVSVELPACVDLLRGGRCAGRTELAGFGVLALV
GE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgcggacgtgacccggggacgcctggtcttcgggggcgactacaacccg
gagcagtggccgcgcgaggtgtggcgcgaggacgtcgagctgatgcgccgggccggcgtg
aatctggtgacggtgggcgtcttctcctgggccaggctggaaccgacgccgggcgcgcgg
gacttcggctggctcgacgaggtgttggacctgctgcacgcgggcgggatcgcggtggac
ctggccacgccgaccgcgagcccgccgccctggctcggccatcgacatccggagacgctg
ccggtcgacgccgacggccgacggctgctgtacggctcccgcaaccagttctgcccgtcc
tcgccgatctaccgcaggcatgccctgtcactggcgaccgacctcgccgagcggtacggt
ggccatccggcgctggcgatgtggcatgtggacaacgagctgtgcgaggtctgccactgc
gacgtcagcgcagcacatttccggcactggctgcgcagtcgctacggcgatgacctggcc
gcgctcaacgaggcctggcacacggtgttctggagccagcgctattcggactgggcggag
atcatgccgccgcgacgggcgccgtacctgatcaatccggcccagcagctggacttccgc
cgtttctcctccgccgcgctgctggagtgcttcgaggtgcagcgcgacgtgctgcgcgcc
gcgacgccggacatcccgatcaccacgaacttcctcggcctggacgccccgctggactac
cgggcgctggccgagcgggaggacgtcgtctctcacgactggtacccggacccgaccaat
ccggccgcgcacgagatgtcgggactgggcttcgacctgatgcgctccctggcgggcggc
ccgtggttcctgatggagggtgcgaccagcgcggtcaactggcggcgccgcaacgccgcc
aaggcgccgggacagctgcgggccgagtcgctgcacgcggtggccaggggcgccgacgcc
gtctgcttcttccagtggcgggcctcccgcgccggggcggagaagtaccactcggggatg
gttccccatgcgggccccgacagtcggatcttccgcgaggtctgcgagctgggggccgag
ctggcggagctgcacgaggtggtggacgccgaggtcgagtgcgaggcggccctggtgctg
gactgggacagctggtgggcggtgcggctcgacgcccacccgacggccgacatcgacgtg
ctcggccgactccgaggcttccacgcggcgctgacccggctcggcgtcgcggtggacgtg
gtggcccccgacgccgacctgtccgcttatcggctggtgatcgcgccgagcctctacctg
gtcaccgacgacgcggcggcgaacctgacgtccttcgtggcgcgcggcggcaccctggtc
ctcgggtacttctccggcatcgtcgacgaacacgaccacatccgcctcggcggttatccc
gcgccgttccgggaggcgctggggctgcggatcgaggagtttgatccgcttcccgagggc
gagacggtgcggtgctcctcgacgctgctcggcggattcgaggcccgcgactggctggag
gagctacgaccggagggcgccgaggtggtggccgaggtcgcggagggacgccgggcgggc
aggccggtggtgctgcgccacgagttcggcacgggcacggcctggtatgtggcgacggag
cccgatcccaccgccttggccgcgttgacccggcaggtgtgcaccgatgcgggggtgacc
ggagtcctggacgggttgcccgccggggtgacggcgacccgccgcggccgggtgctgttc
gtgatcaaccacggtccggaccccgtatcggtggagttgcctgcctgcgtcgatctgttg
cgcggcgggcggtgtgcgggtcggacggagctggcggggttcggggtgctggcgttggtg
ggggagtag

DBGET integrated database retrieval system