KEGG   Actinoalloteichus sp. GBA129-24: UA75_11730Help
Entry
UA75_11730        CDS       T04619                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti00250  Alanine, aspartate and glutamate metabolism
acti00410  beta-Alanine metabolism
acti00640  Propanoate metabolism
acti00650  Butanoate metabolism
acti01100  Metabolic pathways
acti01120  Microbial metabolism in diverse environments
Module
acti_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    UA75_11730
   00650 Butanoate metabolism
    UA75_11730
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UA75_11730
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UA75_11730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acti01007]
    UA75_11730
Enzymes [BR:acti01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     UA75_11730
Amino acid related enzymes [BR:acti01007]
 Aminotransferase (transaminase)
  Class III
   UA75_11730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APU20358
UniProt: A0A1L7F6E1
LinkDB All DBs
Position
2625440..2626693
Genome map
AA seq 417 aa AA seqDB search
MAQLSPLLKQATPVQVARGEGVYLYDHDGRRFLDFTAGIGVTSTGHCHPKVVAAAQQQVA
TLIHGQYTTVMHQPLLTLTERLGEVLPTGLDSLFYVNSGSEAVEAALRLSRQASGRQNVV
VFQGSFHGRTFGAASLTTSGAKIRAGIGPLVPGVTVAPFPYAYRYGWSEQEAVDFALREL
DYLLLTASPAADIAAFFVEPVLGEGGYVPAPPGFLAGLRERADRHGILLVFDEVQTGFGR
TGRFWGHQHFGVEPDILITAKGLASGFPLSAIAASTELMSRGLPGSQGGTYGGNAVSCAA
AVATLEVILEEGLVENAARTGERLLAGSRRIAADHAAVGDVRGLGLMVASEFVESDGSPA
PDTANRVHRAAADLGLLLLTCGPHGNVVRMIPPLVVDEAQIDQGLEIWSKAVAAGLG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttgtcgccactgctcaagcaggcaactccggtgcaggtcgcccgaggagag
ggcgtctacctctatgaccacgacggtaggcgtttcctcgacttcaccgccgggatcggc
gtcacgagcaccggacactgtcacccgaaggtcgtcgcggccgcgcagcagcaggtcgcc
acgctgatccacggccagtacaccaccgtcatgcaccagccgctgctcacgctgaccgaa
cggctgggcgaggtgctgcccaccgggctcgactcgctgttctacgtcaactccggcagc
gaggcggtggaggcggccctgcgactgtcgcggcaggcgagcggcaggcagaacgtggtg
gtgttccagggctccttccacggccggaccttcggcgccgcgtcactgaccacttccgga
gccaagatccgggcaggcatcggaccgctggtccccggtgtcaccgtggcgccgttcccc
tacgcctaccgttacggatggtccgaacaggaggccgtcgacttcgccctgcgggaactc
gactatctgctgctcaccgccagccccgccgccgacatcgccgcgttcttcgtcgagccg
gtcctcggtgagggcggctacgtccccgcgccgcccgggttcctggcgggccttcgcgag
cgggccgaccggcacggcatcctgctcgtgttcgacgaggtgcagaccggattcggtcgg
accggccgattctggggacaccagcacttcggcgtcgagcccgacatcctgatcaccgcc
aagggactggccagcggcttccccctctccgcgatcgccgcgagcaccgagctgatgagc
cgtggcctgcccggttcgcagggcggcacctacggtggcaacgccgtgtcctgcgccgcc
gccgtggcgaccctggaggtcatcctggaggaggggctcgtcgagaacgcggcccgtacc
ggtgagcgactgctggccggttcccgccggatcgcggccgaccatgcggccgtcggcgac
gtgcgcggcctcggcctgatggtggcctccgagttcgtcgagtccgacgggtctcccgcc
ccggacacggcgaaccgcgtgcatcgggcggcagccgacctcggcctgctgctgctcacc
tgcggtccgcacggcaacgtggtccggatgatcccgccgctggtcgtcgacgaggcccag
atcgatcagggtctggagatctggtccaaggcggtcgccgccgggctgggctga

DBGET integrated database retrieval system