KEGG   Actinoalloteichus sp. GBA129-24: UA75_14890Help
Entry
UA75_14890        CDS       T04619                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti00250  Alanine, aspartate and glutamate metabolism
acti00410  beta-Alanine metabolism
acti00430  Taurine and hypotaurine metabolism
acti00650  Butanoate metabolism
acti01100  Metabolic pathways
acti01110  Biosynthesis of secondary metabolites
acti01120  Microbial metabolism in diverse environments
acti02024  Quorum sensing
Module
acti_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UA75_14890
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UA75_14890
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UA75_14890
   00430 Taurine and hypotaurine metabolism
    UA75_14890
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UA75_14890
Enzymes [BR:acti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UA75_14890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APU20988
UniProt: A0A1L7F865
LinkDB All DBs
Position
3315329..3316705
Genome map
AA seq 458 aa AA seqDB search
MVLHSGRRQGPTPQGAGNPFYGLADPAPGSEITLPHQRLGAGPVPPDAALQLVRDELELD
GSARLNLATFVTTWMEPQARELMNDCVAKNMIDKDEYPQTAELERRCVNILADLWHAPEP
ADVIGCSTTGSSEACMLAGMAFKRRWRGPGRPNLVMGANVQICWEKFCQYWEVEPRLVPM
AGDRFHLSADEAVARCDENTIGVVAILGSTFDGSYEPVAEITAALDGLQRRTGLDIPVHV
DGASGAMIAPFLDPGLTWDFRLPRVASINTSGHKYGLVYPGVGWVLWRHRDRLPAELVFK
VNYLGGEMPTFALNFSRPGAEVVAQYYTFARLGREGFRAVQQAARDVATRLADQIAELGP
FRLLTRGDELPVFAFTTNERAAGFTVFDVSRRLRERGWQVPAYTFPADREDLAVLRIVCR
NGFTQDLGDLFVEELRRVLADLDSSPGCGHATETAFHH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcattcgggccgccgccaggggccgaccccccagggagcaggcaatccgttc
tacggcctggccgaccccgcgccgggctcggagatcacgctgccccatcagcggctgggg
gcggggcccgtcccacccgacgccgcgcttcagctcgtgcgcgacgagttggaactcgac
ggcagtgcccgactcaatctcgcgaccttcgtgaccacctggatggagccgcaggcccgc
gagctgatgaacgactgcgtggccaagaacatgatcgacaaggacgagtatccgcagacc
gccgagctggagcgtcgctgcgtgaacatcctcgccgacctgtggcacgcgcccgaaccc
gccgatgtcatcggctgctcgaccaccggctcctccgaggcctgcatgctcgcgggcatg
gcgttcaagcgtcggtggcgcggaccgggcaggcccaacctcgtgatgggcgcgaacgtg
cagatttgttgggagaagttctgccagtactgggaggtggagccccggctcgtgccgatg
gcgggggaccggttccacctcagcgccgacgaggccgtcgcgcggtgcgacgagaacacc
atcggcgtcgtcgcgatcctgggctccaccttcgacggcagttacgagcccgtcgccgag
atcaccgccgcgctcgacggacttcagcggcgcaccggtctcgacatcccggtgcacgtg
gacggcgcctccggcgccatgatcgccccgttcctcgatcccggactgacctgggacttc
cgcctgccgagagtggcgtcgatcaacacctccggccacaagtacgggctggtctatccc
ggtgtgggctgggtgttgtggcggcatcgggaccggctgcctgccgaactggtgttcaag
gtcaactatctcggcggagagatgccgaccttcgcgctcaatttctcccggcccggcgcc
gaggtggtggcgcagtactacaccttcgcccggctgggcagggagggcttccgcgcggtg
caacaggccgccagggacgtggccactcgactggcggaccagatcgcggagctcgggcct
ttccggctgctcaccaggggcgacgaactgccggtgttcgccttcaccacgaatgagcgc
gccgcaggcttcaccgtcttcgatgtctcgcgtcggctgcgagaacgcggctggcaggtc
cccgcctacaccttcccggccgatcgggaggacctggcggtcctgcggatcgtctgccgc
aacggcttcacccaggacctcggcgacctgttcgtcgaggaactgcgtcgagtactcgcc
gatctcgactcctcgcccggttgcgggcatgccacggagaccgccttccaccactga

DBGET integrated database retrieval system