KEGG   Actinoalloteichus sp. GBA129-24: UA75_22835Help
Entry
UA75_22835        CDS       T04619                                 

Definition
(GenBank) DNA polymerase LigD-like ligase domain-containing protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acti00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    UA75_22835
Enzymes [BR:acti01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UA75_22835
DNA repair and recombination proteins [BR:acti03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     UA75_22835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: APU22549
UniProt: A0A1L7FCL6
LinkDB All DBs
Position
complement(5362744..5363898)
Genome map
AA seq 384 aa AA seqDB search
MWVDRAGRSGAGRHVGRFRLLLSSAGRSAPAACLGLFQSAWSAGSGDDGPMSEGSGAGRQ
AERLPVLRPMLATGGQPMPTGPDWAWEFKFDGVRAIAAGDRAGVRLTSRNGNDITATYPE
LTVLGEILGAQRAVLDGEIVAMDDKGRPSFALLQRRMHVQRPTARLTGEIPVACFVFDLL
HLDGVSLLGESYLRRRELLDGLALDGRSARVRVPPSHRDVDPRRLLDIARDNGLEGTIGK
RVASGYRPGVRSRDWLKFPLINTYEVVICGWQPGGGRRAGRIGSLMLGAHDSAGELRYVG
HVGTGFTERMLAELLGMLQPIERPTSPFAGPVPREYSRAAHWVEPRLVGEVVYRTWSPDG
RLRHSAWRGLRPDRDAREISLPAW
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggtcgatcgggccggtcgatcgggcgcaggacgacatgtcggccgattccgtctc
ctcctctcgtccgccggccggtcggccccggccgcctgtctcggactgtttcagtcggcg
tggtcggcgggctcgggcgacgatggcccgatgtcggagggcagcggtgcaggcaggcag
gcggagcgtcttcccgtgctccggcccatgctcgcgaccggcgggcagccgatgccgacg
ggtccggactgggcctgggagttcaagttcgacggcgtgcgggccattgcggcaggcgat
cgggcgggcgtccgcctgacgagccgaaacgggaacgacatcacggcgacctacccggag
ctgacggtgctcggcgagatcctcggcgcgcagcgggccgtgctggacggcgagatcgtc
gccatggacgacaagggcaggccctcgttcgcgctgctgcaacgtcgaatgcacgtccaa
cggccgaccgcccgactgaccggggagatcccggtcgcctgcttcgtcttcgacctgctc
cacctcgatggcgtctcgctgctcggcgagtcctacctccggcggcgggagctgctcgac
ggcctggcgttggacggtcggtccgctcgggtccgagtgccgccgagccaccgggacgtc
gacccccggcggctgctcgacatcgcccgcgacaacggactggaaggcacgatcggcaag
cgggtcgcgtcgggctatcggccaggagtccgcagccgcgactggttgaagttcccgctg
atcaacacctatgaggtggtgatctgcgggtggcagccgggcgggggacggcgggccggg
cggatcggctcgctgatgctcggcgcccatgactcggcaggcgagctgcggtacgtgggg
cacgtcggaaccgggttcacggagcggatgctcgccgagctgctcggcatgctccagccg
atcgaacggccgacgagtccgttcgccgggccggttccgcgcgagtactcccgcgccgcg
cactgggtcgagcctcggctcgtcggggaggtcgtctatcggacgtggagccccgacggc
aggctccggcactcggcctggcgcggccttcgccccgaccgggacgcacgggagatcagc
ctgcccgcctggtag

DBGET integrated database retrieval system