KEGG   Actinoalloteichus sp. GBA129-24: UA75_23415Help
Entry
UA75_23415        CDS       T04619                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
acti  Actinoalloteichus sp. GBA129-24
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Shikimate_DH 3HCDH_N ADH_zinc_N_2 FAD_binding_3 Pyr_redox AlaDh_PNT_C TrkA_N Pyr_redox_2 ApbA NAD_binding_8 NAD_binding_2 adh_short F420_oxidored UDPG_MGDP_dh_N 2-Hacid_dh_C XdhC_C ThiF NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: APU22665
UniProt: A0A1L7FCV4
LinkDB All DBs
Position
5500396..5501385
Genome map
AA seq 329 aa AA seqDB search
MRAAIIDEPGKLRVGEVPDPTPGASDVVVKVGACGICGTDLHIADGEFPPAPFPLVPGHE
FAGEVVEIGSDVRTGIAVGDRVAVDPSLFCGYCTPCRTGHGNLCANWGATGDTVDGAFAE
YVAVPAVNAYRLPDSLSMGEGALVEPLSCAVHGLDVFGAQIGERILVVGAGTMGLLLTQL
LAGSGARVSVVDRNPARLPLATKFGAEHVAVSVAELDAAPFDASVDVTGAPKAIEDAFDA
LRRGGRLQIFGVAADTARISLSPFRIYNDEIKIVGSMAVLDSFEPALRLLETGRVSSEGL
ISHTLPLEEFPEAVGMVRAGTGVKIQIAP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgcgatcatcgacgaaccgggcaagctacgggtgggcgaggttcccgacccc
actcctggtgcctcggacgtggtggtcaaggtcggcgcctgcggcatctgcggcaccgat
ctgcacatcgcggacggtgagttcccgcctgccccgttccccctggtgccggggcacgag
ttcgcgggcgaggtcgtggagatcggttccgacgtccgcaccggcatcgccgtcggcgac
cgggtggccgtcgacccctccctgttctgcgggtactgcacgccctgccgaaccggtcac
gggaacctgtgcgccaactggggcgcgaccggcgacacggtcgacggggccttcgccgag
tacgtcgccgtgcccgccgtcaacgcctaccggctgccggactcgctgagcatgggcgag
ggcgcgctggtggagccgctgtcctgcgcggtgcacgggctcgacgtcttcggcgcccag
atcggcgagcggatcctcgtcgtcggcgccgggacgatggggctgctgctcactcagctg
ctggcgggcagcggtgcgcgggtgtcggtagtggaccgcaatccggcccgcctgccgctg
gctacgaagttcggtgccgagcacgtcgccgtcagcgtcgcggagctggacgccgcgccg
ttcgacgcatcggtggacgtgaccggggcgccgaaggccatcgaggacgccttcgacgcg
ctgcggcgcggcggcaggctgcagatcttcggcgtggccgccgacaccgcacggatcagc
ctctccccgttccgcatctacaacgacgagatcaagatcgtgggctcgatggccgtcctg
gacagcttcgaacccgccctgcgactgctggagaccgggcgagtcagcagcgagggactc
atcagccacaccctcccccttgaggagtttcccgaggccgtggggatggtgcgcgcgggc
acgggagtcaagatccagatcgctccctga

DBGET integrated database retrieval system