KEGG   Actinoalloteichus sp. GBA129-24: UA75_28105Help
Entry
UA75_28105        CDS       T04619                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti00020  Citrate cycle (TCA cycle)
acti00480  Glutathione metabolism
acti01100  Metabolic pathways
acti01110  Biosynthesis of secondary metabolites
acti01120  Microbial metabolism in diverse environments
acti01130  Biosynthesis of antibiotics
acti01200  Carbon metabolism
acti01210  2-Oxocarboxylic acid metabolism
acti01230  Biosynthesis of amino acids
Module
acti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
acti_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UA75_28105
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UA75_28105
Enzymes [BR:acti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UA75_28105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: APU23592
UniProt: A0A1L7FFJ4
LinkDB All DBs
Position
complement(6586052..6587269)
Genome map
AA seq 405 aa AA seqDB search
MGKIKVQGKVVELDGDEMTRIIWQFIKDRLVHPYLDVDLEYYDLGIESRDATDDQITIDA
ANAIAKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIIENIPRL
VPGWTKPIIIGRHAHGDQYKASDFKVPGPGTVTISYTPADGSEPLELEVAQFPEGGGVAI
GMYNFRKSIEDFARASLAYGLQRNYPVYMSTKNTILKAYDGMFKDVFEEIFEKEFKAEFD
KQGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWSRGLAHRGKLDETPEVIEFAHTLE
KVVIETVESGKMTKDLAVLVGKDQGFQTTEEFLASLDENLAKKLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtacagggcaaggtcgtcgagctcgacggcgacgagatgaccagg
atcatctggcagttcatcaaggaccggctggtccacccctatctcgatgtcgatctggag
tactacgacctcggcatcgagagccgcgacgccacggacgaccagatcaccatcgacgcg
gccaacgcgatcgcgaagcacggtgtcggcgtgaagtgcgccaccatcacgccggacgag
gccagggtcgaggagttcggcctcaagaagatgtggcggagccccaacggcaccatccgc
aacatcctcggcggcgtcgtgttccgcgagccgatcatcatcgagaacatccctcggctg
gtgcccggctggacgaagccgatcatcatcggcaggcacgcgcacggtgaccagtacaag
gccagcgacttcaaggtccccggccccggcaccgtgacgatcagctacacgcctgccgac
ggcagcgagccgctggagctggaggtggcgcagttccccgagggcggcggcgtcgccatc
ggcatgtacaacttccggaagtcgatcgaggacttcgcgcgggcctcgctggcctacggc
ctccagcgcaactacccggtctacatgtcgaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatcttcgagaaggagttcaaggccgagttcgac
aagcaggggctcacctacgagcaccggctgatcgacgacatggtggcctccgcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggcctgatgacctcggtgctgatgactccggacggc
cgcacggtcgaggccgaggctgcgcacggcacggtcacccggcactaccggcagcaccag
cagggcaagccgacctccaccaacccgatcgcgtcgatcttcgcgtggagccgaggactg
gcacaccggggcaagctcgatgagacccctgaggtcatcgagttcgcgcacactctggag
aaggtcgtcatcgagacggtcgagagtggcaagatgaccaaggacctcgccgtgctggtc
ggcaaggaccagggcttccagaccaccgaggagttcctggcgagcctggacgagaatctg
gcgaagaagctggcctag

DBGET integrated database retrieval system