KEGG   Actinoplanes sp. N902-109: L083_0501Help
Entry
L083_0501         CDS       T02655                                 

Definition
(GenBank) DNA polymerase LigD ligase region
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:actn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    L083_0501
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:actn03400]
    L083_0501
Enzymes [BR:actn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     L083_0501
DNA repair and recombination proteins [BR:actn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     L083_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AGL14011
UniProt: R4L9R0
LinkDB All DBs
Position
522763..523692
Genome map
AA seq 309 aa AA seqDB search
MLATAGELPLGAAWSYEFKWDGVRVLASFEGGPPRLWARSGAVVTPAYPELGALTLPPGT
LLDGEMVVLNQLGRPSFTALAERMHVRDTSKAARLVVTLPVTYMIFDLLALGGRPLLDLP
YADRRARLEDLDLGVGRWTVPPVFADGVATEAAARENNLEGVVAKRLGSTYLPGARSPDW
VKVKFDRTGDYVIGGWRAGARRLGGLLVGLPEPDGKLRFRGRVGGGIGSAAEQDLLSALT
PLVTAASPFAAGAVPREDARGAHWVKPDLVVEVRYGNRTPDGRLRFPRFLRLRPDKSPGD
CVEEDDDGS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccaccgcgggtgagctgccgctgggtgcggcctggagctacgagttcaaatgg
gacggcgtgcgggtgctggcgtccttcgagggcggtccgccccggttgtgggcgcgctcg
ggggcggtggtcaccccggcctacccggagctcggcgcgctgacgctgccgcccggcacc
ctgctcgacggcgagatggtggtgctcaaccagctcgggcgcccctcgttcaccgcgctg
gccgagcgcatgcacgtccgggacaccagcaaggcggcccggctggtggtgaccctgccg
gtcacctacatgatcttcgacctgctggcgctgggtggccggccactgctcgatcttccg
tacgccgaccggcgcgcccgcctggaggacctcgacctcggggtggggcggtggaccgta
cccccggtcttcgccgacggggtggccaccgaggccgccgcccgggagaacaacctggag
ggcgtggtcgccaagcggctgggctcgacgtacctgccgggtgcgcgctcgccggactgg
gtcaaggtgaagttcgaccggaccggcgactacgtgatcggcggctggcgggccggggcg
cggcggctgggcggcctgctggtgggcctgcccgagccggacggcaagctgcgtttccgc
ggccgggtgggcggtggcatcggctcggcggccgaacaggacctgctgtcggcgctgacc
ccgctggtgaccgcggcttcgccgttcgccgcgggcgcggtgccccgggaggatgcccgc
ggcgcgcactgggtaaagcccgatctggtggtcgaggtgcgctacggcaaccggaccccg
gacgggcggctgcggttcccgcggttcctgcggctgcgcccggacaagtcgcccggtgac
tgcgtggaggaggacgacgatggcagctga

DBGET integrated database retrieval system