KEGG   Actinoplanes sp. N902-109: L083_0738Help
Entry
L083_0738         CDS       T02655                                 

Definition
(GenBank) myo-inosose-2 dehydratase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00562  Inositol phosphate metabolism
actn01100  Metabolic pathways
actn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    L083_0738
Enzymes [BR:actn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     L083_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: AGL14248
UniProt: R4L6L3
LinkDB All DBs
Position
complement(818719..819549)
Genome map
AA seq 276 aa AA seqDB search
MRIAGAPISWGISEVPGWGHQLPVERVLSEMRDLGLTATEFGPAGFLPSDDLLSSYGLSA
VGGFVPVVLHTGNPTVDFDRFVAAGADTVVLAAATGLDGYDARPAMDPDGWRALLTTVDR
IAADARTKGLSAVLHPHVGTMIERADEVQRVLDGSAVALCLDTGHLLIGGTDPAELAERA
GDRIAHVHAKDVDADLAAEVRTGRRTFTDAVRAGMFRPIGDGDVDFDRVAKALRRHGYAG
WWVLEQDTILTGAESGARPAADVRRSIDRLRAICTA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgccggagcccccatctcgtggggcatcagtgaggtgccgggctggggccac
cagttgccggtcgaacgggtgctgagcgagatgcgcgacctcggcctcaccgccaccgag
ttcggcccggcgggcttcctgccctccgacgacctgctttcctcgtacggcctgagcgcg
gtcggcggcttcgtaccggtggtcctgcacaccggaaaccccactgtggacttcgaccgt
ttcgtggccgccggcgcggacaccgtcgtgctggccgcggcgaccgggctcgacggttac
gacgcccggccggccatggaccccgacgggtggcgggcactgctgaccacagtggatcgg
atcgctgcggacgcccgtacgaagggattgtcagcggttctgcacccgcacgtcggcacc
atgatcgaacgcgccgacgaggtccagcgggtgctcgacggctcggccgtagcgctctgc
ctcgacaccggccatctgctcatcggcggcaccgacccggccgagctcgccgaacgcgcc
ggcgaccggatcgcccacgtgcacgccaaggacgtcgacgccgacctggccgccgaggtg
cgcacgggccggcggacgttcaccgatgcggtgcgcgcgggcatgttccgcccgatcggc
gacggcgacgtggacttcgaccgggtcgcgaaagcgttgcggcgccacggttacgccggc
tggtgggtcctggagcaggacaccatcctgaccggggccgaatcgggggcccggccggca
gcggacgtgcggcgcagcatcgaccggctgcgtgccatttgcacggcctga

DBGET integrated database retrieval system