KEGG   Actinoplanes sp. N902-109: L083_1597
Entry
L083_1597         CDS       T02655                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00900  Terpenoid backbone biosynthesis
actn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L083_1597
Enzymes [BR:actn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     L083_1597
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AGL15107
UniProt: R4L6H0
LinkDB
Position
1760106..1760888
AA seq 260 aa
MSRPPTPHISGATPPSLPKEALPKHVALVMDGNGRWAKERGLSRTKGHEQGEHSLFDTIE
GALEIGIPYLSAYAFSTENWKRSPEEVRFLMGFNRDVIHRRRDELTDLGVRVVWSGRTGR
LWKSVISELQTAEEQSRKNTKLTLQFCVNYGGQAEIADATAAIARDVAAGKLKPDKINEK
TIQRYLYHPEIPDVDLFLRPSGEQRTSNFLLWQSAYAELVFLDTLWPDFDRRHLWYACEL
YARRDRRFGGAIPNPVAPPT
NT seq 783 nt   +upstreamnt  +downstreamnt
gtgagccgtccgcccacgccgcacatctccggcgccaccccgcccagcctgcccaaggaa
gcgctgcccaagcacgtggcgctggtgatggacggcaacggccggtgggccaaggagcgt
ggcctgtcccgcaccaagggccacgagcagggcgagcactcgctgttcgacaccatcgag
ggcgcgctggagatcggcatcccctacctctcggcgtatgcgttctccaccgagaactgg
aagcgctcgcccgaggaggtccgtttcctgatgggcttcaaccgcgacgtcatccaccgc
cgccgcgacgagctcaccgatctgggcgtccgggtggtctggtcgggccgcaccggccgg
ctgtggaagagcgtgatctccgagctgcagaccgccgaggagcagtcccgcaagaacacc
aagctgaccctgcagttctgcgtcaactacggcggccaggccgagatcgccgacgcgacc
gccgccatcgcccgggacgtggcggccggcaagctcaagccggacaagatcaacgagaag
acgatccagcgttacctctaccatcccgagatcccggacgtggacctcttcctgcgcccc
tccggcgagcagcgcacctccaacttcctgctgtggcagtcggcgtacgccgagctggtc
ttcctcgacacgctctggcccgacttcgaccgccgccatctctggtacgcctgcgagctc
tacgcccggcgcgaccgtcgcttcggcggggccatccccaaccccgtcgccccgcccacg
tga

DBGET integrated database retrieval system