KEGG   Actinoplanes sp. N902-109: L083_3461Help
Entry
L083_3461         CDS       T02655                                 

Definition
(GenBank) alcohol dehydrogenase groes domain-containing protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00010  Glycolysis / Gluconeogenesis
actn00071  Fatty acid degradation
actn00350  Tyrosine metabolism
actn00625  Chloroalkane and chloroalkene degradation
actn00626  Naphthalene degradation
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
actn01120  Microbial metabolism in diverse environments
actn01130  Biosynthesis of antibiotics
actn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L083_3461
  Lipid metabolism
   00071 Fatty acid degradation
    L083_3461
  Amino acid metabolism
   00350 Tyrosine metabolism
    L083_3461
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L083_3461
   00626 Naphthalene degradation
    L083_3461
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     L083_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N CoA_binding Methyltransf_31 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AGL16971
UniProt: R4LIY0
LinkDB All DBs
Position
complement(4116840..4117850)
Genome map
AA seq 336 aa AA seqDB search
MRAAVVTGFDQPVQVKEVPVPEPGPGQIQVRIEASGLCHTDIHAARGDWPVKPAPPFVPG
HEGVGIVERTGPGVTEHRVGDRVAVPWLGHACGTCEYCITGWETLCEQQLNTGYAIDGGH
AEFLVADARYAVAVPAGLDPAEAAPLTCAGVTTYKAVKVGGVTPGDRVAIFGVGGLGHLA
LQYAQIFGGETIAVDVTEEKLALAKQLGAAHVVNAATTDPVAAIEALGGADVAVVLAADP
TVLEQAHAALRRGGRLVLVSLPKDNTMALPIFQTVLKGIRVIGSIVGSRADLAAVFRLHA
AGRTRVILQTRPLEQINDAIDEVLAGRVPARLVLIP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccgtggtcaccggcttcgaccagcccgtgcaggtcaaggaggtgcccgtc
ccggaaccggggccgggccagatccaggtccggatcgaggcgagcgggctgtgccacacc
gacatccacgccgcccgcggcgactggccggtcaagcctgccccgccgttcgtgccgggg
cacgagggcgtcggcatcgtggagcgcaccgggccgggcgtcaccgagcaccgggtcggc
gaccgggtcgctgtcccctggctcgggcacgcatgcggcacctgcgagtactgcatcacc
ggctgggagacgctgtgcgagcagcagctcaacaccggctacgcgatcgacggcgggcat
gccgagttcctggtggccgacgcccggtatgcggtcgcggtgcccgccgggctggacccc
gccgaggcggccccgctcacctgcgccggggtcaccacgtacaaggcggtcaaggtcggc
ggggtgacgccgggcgaccgggtggcgatcttcggggtcggcgggctggggcatctcgcg
ctgcagtacgcgcagatcttcggcggggagaccatcgcggtggacgtgaccgaggagaag
ctggccctggccaagcagctcggcgccgcgcacgtggtcaacgccgccaccaccgacccg
gtggcggcgatcgaggcgctcggcggggccgacgtggccgtggtgctggcggccgacccc
acggtgctggagcaggcgcacgccgcgctgcgccggggcggccggttggtgctggtgtcg
ctgcccaaggacaacacgatggcgctgccgatcttccagacggtgctcaaggggatccgg
gtgatcggttcgatcgtgggcagccgggccgatctggccgcggtgttccggctgcacgcc
gccgggcgtacccgggtgatcctgcagacccgcccgctggaacagatcaacgacgcgatc
gacgaggtgctggccggccgggtgccggcgcggctcgtgctgattccctga

DBGET integrated database retrieval system