KEGG   Actinoplanes sp. N902-109: L083_3633Help
Entry
L083_3633         CDS       T02655                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00500  Starch and sucrose metabolism
actn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L083_3633
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     L083_3633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGL17143
UniProt: R4LFF0
LinkDB All DBs
Position
complement(4319706..4321982)
Genome map
AA seq 758 aa AA seqDB search
MTSSLVAGLLGIATVTAMSGGPGLPPAPAGEAAPAPGATPASGAAPASRVALAPGAALAV
PGALASGAAPASRVALASGAAPGAPGVDEQYLPADKSGLGTTTTTASRVWFTVQKEGGLG
EVYYPTVGSPSTRALEFVVADRRGHAVRANAAATVRTTLIDERSLSYRQTFTERAHRWHL
TTTYTSDPARSTVLINVSFTGRGYDLFTVYDPALANTRAGDSGRTAGSTLVATDGSTASA
LVASPAFTATSNGFRGVSDGWTDLLTDGRMDWHYQSTGDGNLVQTAAINPHTTLALGFGT
PATAAATARASLRRGFGAVARDYAYGWHRYLGTLRNPPHGSDPRLYRVSVMVLAASEDKT
HRGAYVAAPAMPWAFGRDDPSGPYHLVWSRDLYQIATALIAAGDVAGAGRALDFLFGAQQ
QQPDGSFPQNSQVDGTPVWGGLQLDEVALPIVLAGQLHRTGPSTWQHVRRAADFLTGFTQ
DGNRAPWSPQERWENQSGYSPATIAAGIAGLVCAADIARANGDPAAAQRYLATADDWRAH
VKDWTVTSTGPYSPKPYFLRLTKDGNPDAGTTYTIGDSGPSDVDQRRVVDPSFLDLVRLG
VLPPDDPAVVNSTHVVDAQLGVPTARGFFWHRASFDGYGEKLDGSQWDYGFPDDSLITRG
RAWPLLNGERGEYDLARGHVGAARAQLATMARSAGPGSLLPEQVWDNQGPGVPGTPTFSA
TPLAWTHAQYVRLAVDTAAGRVLEQPAVVAKRYLRPGG
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcctccctcgtcgccgggctcctcggcatcgcaacggtcaccgccatgagcggc
gggcccggtctcccgcccgctcccgccggggaagcagcacccgccccgggagccacgccc
gcctccggggctgcgccggcctcgcgggtggcgctcgccccgggcgccgcgctcgctgtg
ccgggcgcgctcgcctccggggccgcgccggcctcgcgggtggcgctcgcctccggggcc
gcgccgggtgcacccggggtggacgagcagtaccttcccgcggacaagtccggcctcggc
acgaccaccacgaccgccagccgggtgtggttcacggtgcagaaggaaggtgggctcggc
gaggtctactacccgaccgtcggctcccccagcacccgcgccctcgagttcgtggtcgcc
gaccgccgcgggcacgccgtccgggcgaacgcggcagccacggtccgcaccacgctcatc
gacgagcgcagtctcagctaccggcagacgttcaccgaacgagcccaccggtggcacctc
accacgacatacaccagtgatcccgcccgatccactgtgttgatcaacgtatcgttcacc
ggccgcggctacgacctcttcaccgtgtacgacccggccctggccaacacccgcgccggc
gacagcggccgcacggccgggagcacgctcgtcgccacggacggctcgacggccagtgcg
ctggtcgcctcgcccgccttcaccgccacctccaacggtttccgcggcgtgagcgacggc
tggacggacctgttgaccgacggacgcatggactggcactaccagtcgacaggtgacggc
aatctcgtccagacggccgcgatcaacccgcacaccaccctcgcgctcgggttcggcacc
ccggcgacggcggcggccaccgcacgggcgtcgctgcggcgcggattcggtgcggtggcg
cgcgattatgcgtacggatggcaccggtatctcggcacgctgcgcaacccgccgcacggc
agcgacccgcggctctatcgcgtgtcggtgatggtgctggcagcgagcgaggacaagacg
caccgcggggcgtacgtcgcggcgcccgcgatgccgtgggcgttcggccgcgacgacccg
tcggggccctaccacctggtgtggtcgcgcgacctgtaccagatcgccaccgcgctgatc
gccgccggtgacgtcgccggggcgggccgggcgctggacttcctgttcggggcgcagcag
cagcagccggacggctcgttcccgcagaattcccaggtcgacggcacaccggtgtggggc
ggcctgcagctggacgaggtcgcgttgccgatcgtactggccggtcaactgcaccgcacc
ggtccgtcgacctggcagcacgtccggcgcgccgcggacttcctgaccggcttcacccag
gacggcaaccgcgcgccgtggtcgccgcaggagcgctgggagaaccagtcgggctactcc
cccgccaccatcgccgccgggatcgcgggcctggtctgcgccgctgacatcgcccgcgcc
aacggggacccggccgcggcgcagcgttacctggccaccgccgacgactggcgggcacac
gtcaaggactggacggtgaccagcaccgggccgtactcgccgaagccctatttcctgcgc
ctgaccaaggacggcaacccggacgccggcaccacctacaccatcggcgacagcggcccg
tccgacgtcgaccagcgccgggtggtcgaccccagcttcctcgacctggtacggctgggc
gtcctgccgcccgacgaccccgccgtcgtcaactcgacccacgtcgtcgacgctcaactc
ggcgtgcccaccgcccgtggcttcttctggcaccgcgcctccttcgacggctacggcgag
aagctcgacggcagtcagtgggactacggtttccccgacgactcgctcatcacccgtggc
cgtgcgtggcccctgctcaacggcgaacgcggcgagtacgacctcgcccgcggccacgtc
ggtgcggcccgggcccaactggccacgatggcccgcagtgccggacccggatccctgctg
cccgagcaggtctgggacaaccagggcccgggcgtccccggcacccccacgttctcggcc
accccgctggcctggacgcacgcccagtacgtccgcctcgccgtggacaccgccgccggc
cgggtcctggagcaaccggccgtcgtcgccaagcgctatctccggcccggaggctga

DBGET integrated database retrieval system