KEGG   Actinoplanes sp. N902-109: L083_5273Help
Entry
L083_5273         CDS       T02655                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00564  Glycerophospholipid metabolism
actn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    L083_5273 (glpD)
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     L083_5273 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGL18783
UniProt: R4LK26
LinkDB All DBs
Position
complement(6043602..6045311)
Genome map
AA seq 569 aa AA seqDB search
MTDAALSPDAREAALTALAGTEVDVLVVGGGVVGAGCALDAVTRGLTVGLVEARDFASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLILQRLAPHLARPVPFLYPLKHRLWERLY
AGTGVQLYDLMATAHGGLPRHRNLSRRSALRVCPALKKDALVGALQYYDAQLDDARHTMF
LARTAAAYGAHVANRTEVVGFLREGERVTGVRVHDLERDRTFEIRAQQVVNATGVWTDDT
QALVGERGQFHVRASKGIHLVVPRDRIQSRTGLILRTPTSVLFVIPWGRHWIIGTTDTDW
SLDKAHPAASSTDIDYLLGQVNEVLATPLDRTDVQGVYAGLRPLLSGESESTSQLSREHT
VGSPVPGLVVVAGGKYTTYRVMARDAIDAAVHNLGRSVPRSCTERVPLLGAEGYAALWNR
RRLLAEESGLHVARVEHLLGRYGSLVHEVLALVREDPSLGRPLDGAEDHLRAEITYAAGH
EGARHLEDVLTRRTRISIETFDRGVGAAPMAADLMGDVLHWSKEQREREVTNYRLRVEAE
RASQEQPDDETADAARLGAPDVVPVHATA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
ttgactgacgcagctctctccccagacgctcgcgaggccgcgctcaccgcgcttgccggc
accgaggtcgacgtgctggtcgtgggtggcggcgtggtgggtgccgggtgcgccctcgac
gcggtcacccgtggcctcacggtcggtctcgtcgaggcccgcgacttcgcctccggcacc
tccagccgctccagcaagctgatccacggcgggctgcgctacctggagatgctcgacttc
gccctggtccgcgaggccctcaaggaacgcggactgatcctgcagcggctcgccccgcac
ctggcccgcccggtgccgttcctctatccgctcaagcaccggctttgggaacgtctgtat
gccgggaccggcgtgcagctctacgacctgatggccaccgcccacggcgggctgccccgg
caccgcaacctgtcccgccgcagcgcgctgcgggtctgcccggcgctcaagaaggacgcg
ctggtcggggcgctgcagtactacgacgcccagctcgacgacgcccggcacaccatgttc
ctggcgcgcacggcggcggcgtacggcgcgcacgtggccaaccgtacggaagtggtgggt
ttcctgcgcgagggcgaacgggtcaccggcgtgcgcgtgcacgacctggaacgcgaccgt
accttcgagatccgcgcccagcaggtcgtcaacgcgaccggggtgtggaccgacgacacc
caggccctggtcggcgagcgcgggcagttccacgtccgcgcgagcaaggggatccacctg
gtggtgccgcgcgaccggatccagtccagaaccggactgatcctccgtacgccgacaagc
gtgctgttcgtgatcccgtggggccgccactggatcatcgggaccacggacaccgactgg
agcctggacaaggcgcaccccgcggcgtccagcaccgacatcgactacctgctgggccag
gtcaacgaggtgctggcgacacccctggaccgtaccgacgtgcagggggtctacgccggg
ttgcgcccgttgctctccggcgagtccgagtcgacgtcgcagctgtcgcgcgagcacacc
gtcggcagcccggtgcccggcctggtcgtggtggccggcggcaagtacaccacctaccgg
gtgatggcccgcgacgccatcgacgcggccgtgcacaacctcggccgctcggtgccgcgc
tcctgcacggaacgggtcccgctgctgggtgcggagggctacgcggcactgtggaaccgc
cgccgcctgctggccgaggagtccgggctgcacgtggcccgggtcgagcacctgctgggc
cgctacggcagcctggtgcacgaggtgctcgcgctggtccgcgaggacccgtcgctcggc
agacccctcgacggcgccgaggaccacctgcgcgccgagatcacctacgccgccggccac
gagggcgcccgccacctcgaggacgtgctcacccgccgcacccgcatctccatcgagacc
ttcgaccgcggcgtcggcgccgcccccatggccgccgacctcatgggtgacgtcctgcac
tggagcaaggagcagcgggaacgcgaggtgaccaactaccgcctgcgcgtcgaggcggaa
cgggcctcgcaggaacagccggacgacgagaccgcggacgccgcccggctgggcgccccg
gacgtggtgccggtgcacgccacggcctga

DBGET integrated database retrieval system