KEGG   Actinoplanes sp. N902-109: L083_5377
Entry
L083_5377         CDS       T02655                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00997  Biosynthesis of various secondary metabolites - part 3
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    L083_5377
SSDB
Motif
Pfam: DeoC OMPdecase DUF561 TMP-TENI AP_endonuc_2 NMO
Other DBs
NCBI-ProteinID: AGL18887
UniProt: R4LHU6
LinkDB
Position
complement(6159111..6159893)
AA seq 260 aa
MHDNGVFGRRLRLRHLYRRDTTGLLVVPLDHPIAGGPLWPAGPDRLDRLVADVAAAGADA
VVLHKGAVRRVHPARFRDVSLVLHLTAGTGLAADPDAKYPVASVEEALRLGAEAVSVHVN
VSSLTEDRQVAHLAAVAEQCDRWGMPLLAMMYVRGPDTLDGTSETLVARALAVAAELGAD
LVKTSLPAAPEAITRITAACPVPVLAAGGAGAAPATLGAALRAGAGGLAVGRLVFTAPDP
AAMTRRLSEMVHHKELAVTS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcacgacaacggcgttttcggccgccggctgcggctgcgccacctgtaccgccgcgac
accaccgggctgctggtggtgccgctcgaccacccgatcgccggcggcccgctgtggccg
gccggcccggaccggctggaccggctggtcgccgacgtggccgccgccggggccgacgcg
gtggtgctgcacaagggtgcggtccggcgggtgcacccggcccggttccgcgacgtctcg
ctggtgctgcacctcaccgcgggcaccgggctggccgccgacccggacgcgaagtacccg
gtggccagcgtcgaggaggcgctgcggctgggcgcggaggcggtgagcgtgcacgtcaac
gtgagttcgctgaccgaggaccggcaggtggcccatctggcggcggtggccgagcagtgc
gaccgctgggggatgccgctgctggccatgatgtacgtccgcggcccggacaccctggac
ggcacgtccgagacgctggtggcccgggccctcgcggtcgccgccgagctgggcgccgac
ctggtcaagaccagcctgcccgcggcaccggaggcgatcacccggatcaccgcggcctgc
ccggtgccggtgctggccgccgggggcgccggcgcggcaccggccaccctgggcgccgcg
ctgcgggccggcgcgggcgggctcgccgtgggccgcctggtcttcaccgcccccgacccg
gccgccatgacccgccggctgtccgagatggtccaccacaaggaattggcggtgacgtcg
tga

DBGET integrated database retrieval system