KEGG   Actinoplanes sp. N902-109: L083_5573Help
Entry
L083_5573         CDS       T02655                                 

Definition
(GenBank) Non-ribosomal peptide synthase
Organism
actn  Actinoplanes sp. N902-109
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGL19083
UniProt: R4LKX5
LinkDB All DBs
Position
complement(6386348..6389512)
Genome map
AA seq 1054 aa AA seqDB search
MPTDQLTPAEERLWFAEQRNRATPVYHLSVHYRFTGRLDVERLRTALDELAARHPALRRG
FTAPGRSFTLPSASPAPVSPRSASPAPVSPPSANAAPVSPPSASPLPPSPPPPSAAPVSA
PGATTTRVSVPLECRDARDLPEAQVQRLLDTAARTPFDLAAPPLLRALLVTGASGDQLLL
TVHHLVCDGTSMARLEAELEELYTGVGPAPEPVVAVRQQRRDEGKALAYWRAALTGAPAG
LSLPHDRARPRVLGVAGATHALPLPPELPAAMEALAARERLSPFMVWVLAYVAGLTAVTG
DRDLVIAVPVSARRPEQQAEIGMFADIVPLRFVLPPGLTGRGLAALVRSTVAGALAYGHV
PFQTLVERLWPKDDRLRAPLAQAALTYVDATGCALRAGTPSVHRELLPTGTAKFEVLWAV
TRHPGRTVAELEYSTELFTERAAAALHQRMLAAATAVLTRPDAELPGGPAEPPNETPVHE
HVRRHVATRPDAVAVRHHEVRLTYRQLDDRAAVIAAGLRAAGLRRGGVVALPMVRSADAV
AACLGVLYAGCAYLPIDVNQPHERIRGIVRGTAHAAVVADDTMAGALAGLVPVLPLATLT
GRDERFRSVRITGGDVAYVMSTSGSTGRPKAVVVPHRAITRLVIGADYVTVDPSDRVAHL
SNPAFDAATFEIWGALANGATLVVEDRDVALSPPRLSAFLEQQRITVMWLTATLLHQVVD
FAPDALRHLRVLLFGGEQADERRLAKLLAGHPPAQLINGYGPTENTTFSTCHEVSAADIA
AGVVPIGRAIRGTTAHALDAAGDPVPEGETGELYVGGAGLALGYLGAPELTAAAFVPDPF
DPRGGRRLYRTGDLVRVRPGGGYEFVGRADDQVKVRGFRVELGEIELALRRQPGVTAAVV
FARPSPHGTEIVAGVAADPAGRAELDRRLRAELPDYLVPTLVVLDRIPVNANGKADRTAL
LAASRPAPEPIEEPETGAVAAIWCEVLDREHARPGDNFLTHGGHSLLALRLLSRLDEELG
VQLDLADFLADPTLRGLTALVAQAEPTAIERSQP
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgaccagctcaccccggccgaggagcggctgtggttcgccgagcaacgcaac
cgtgccacgccggtctaccacctcagtgtccactaccgcttcaccggccggctggacgtc
gagcggctgcgcacggcgctcgacgaactcgccgcccgtcatcccgccctgcgccgaggt
ttcaccgcgccaggccgcagcttcaccctgccgtcagcgagccccgcgccggtgagcccg
cggtcagcgagccccgcgccggtgagcccgccgtctgcgaacgcggcgccggtgagcccg
ccgtcagcaagcccgctgccgccgagcccgccgccgccgagcgcggcaccggtgagcgcc
ccaggagcgaccacgacgcgggtcagcgtgccgctggagtgccgggacgcccgtgacctc
cccgaggcgcaggtgcagcggctgctggacaccgccgcgcgcacgccgttcgacctggcg
gcaccgccgttgctgcgggcgctgctggtgaccggtgcgagcggcgaccagttgctgctc
accgtgcatcatctggtgtgcgacggcacctcgatggcccggctggaggccgagctggag
gagctgtacaccggggtcggcccggcgccggagccggtcgtggcagtgcggcagcagcgg
cgggacgagggcaaggccctggcgtactggcgggctgcgctcaccggcgcgccggccggg
ctgtcgttgccgcacgaccgggcccggccgcgggtgctgggcgtcgcgggggccacccac
gcgctcccgctcccgcccgaactaccggccgcgatggaggcgctggccgcccgggaacgg
ctcagcccgttcatggtgtgggtgctggcctacgtcgccgggttgaccgcggtgaccggt
gaccgggacctggtgatcgctgtgccggtgtcggcgcgccgaccggagcagcaggccgag
atcgggatgttcgccgacatcgtgccgttgcggttcgtgttgccgccggggctgaccggg
cgcgggctggccgctctggtgcgcagcaccgtcgccggggcgctcgcctacggtcatgtg
ccgttccagaccctggtcgagcggttgtggccgaaggacgaccggctgcgcgcgccgctg
gcccaggccgcactgacctatgtggacgcgactggttgcgcgctgcgggccgggacgccg
tcggtgcatcgcgagctgctgcccaccggcaccgccaagttcgaggtgctgtgggcggtc
acccggcatcccggtcgtacggtggccgagctggagtacagcaccgagctgttcaccgaa
cgggcggcagccgccctgcaccagcggatgctggccgccgcgaccgcggtcctcacccgg
cccgatgccgaactgccgggcggtcccgcggagccgccgaatgagaccccggtgcacgag
catgtccgacggcatgtggctacccgcccggacgccgtggccgtgcggcatcacgaggtg
cggctgacctatcgccagctggacgatcgggccgcggtgatcgcggccgggctgcgtgcg
gccgggctgcgccggggcggtgtggtggcgctcccgatggtgcgcagcgcggatgcggtc
gcggcctgtctcggcgtcctctacgccggttgcgcctacctccccatcgacgtcaatcaa
ccccacgagcgtattcgcggcatcgtacggggtaccgcgcacgccgccgtcgtcgccgac
gacaccatggccggcgccctcgccgggctggtgccggtgctgcccctggccacgctgacc
ggccgggacgaacgcttccggtcggtgcggatcaccggtggcgacgtggcgtacgtgatg
tccacctcggggtcgaccgggcggccgaaggccgtggtcgtgccgcaccgcgcgatcacc
cggctggtcatcggggccgactacgtcaccgtcgatcccagcgaccgggtggcgcacctg
tcgaacccggcgttcgacgcggccaccttcgagatctggggcgcgctggccaacggcgcc
accctggtggtggaggaccgcgacgtggcgctgtccccgccgcggctgagcgccttcctc
gagcagcagcgcatcacggtcatgtggctcaccgccacgctgctgcaccaggtcgtcgac
ttcgccccggacgccctgcggcacctgcgggtgctgctgttcggcggcgagcaggccgac
gagcggcggctggcgaagctgcttgccgggcacccgccggcccagttgatcaacgggtac
gggccgaccgagaacaccacgttcagcacctgtcacgaggtgagcgccgcggacatcgcc
gccggggtggtgccgatcggccgggcgatccgcggcaccacggcccatgccctcgacgcg
gccggcgacccggtgccggagggggagaccggcgagctgtacgtcggcggcgccgggctg
gccctcggctacctcggtgcgccggagctgaccgcggcggccttcgtgcccgacccgttc
gacccgcgtggcggccggcggttgtaccgcaccggcgacctcgtgcgggtccggcccggc
ggcgggtacgagttcgtgggccgcgccgacgaccaggtcaaggtgcgcggcttccgggtc
gagctgggcgagatcgagctggccctgcgccgccagccgggggtgaccgcggcggtggtg
ttcgcccggccctccccgcacggcaccgagatcgtcgccggggtggccgcggacccggcc
ggccgggccgagctggaccggcggctgcgcgcggaactgcccgactacctggtcccgacg
ctggtggtgctcgaccggataccggtcaacgccaacggcaaagccgaccgtaccgcgctg
ctcgccgcgagcaggccggcgccggagccgatcgaggagccggaaaccggtgctgtcgcg
gcgatctggtgcgaggtcctcgaccgcgagcacgcccggcccggcgacaacttcctgacc
cacggcgggcactccctgctcgccctgcgcctgctgtcccggctcgacgaggagctcggc
gtgcagctcgacctggccgacttcctggccgaccccaccctgcgcggcctgaccgccctg
gtggcgcaggccgaacccaccgccatcgaacggagtcaaccatga

DBGET integrated database retrieval system