KEGG   Actinoplanes sp. N902-109: L083_5679Help
Entry
L083_5679         CDS       T02655                                 

Definition
(GenBank) threonine dehydrogenase
Organism
actn  Actinoplanes sp. N902-109
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AdoHcyase_NAD Pyr_redox_2 HI0933_like Pyr_redox Pyr_redox_3 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGL19189
UniProt: R4LU24
LinkDB All DBs
Position
6540904..6541884
Genome map
AA seq 326 aa AA seqDB search
MEPSAPAAGEVQIAVAYCGLCGTDLHIAHGNMDARVRTPLIFGHEASGTVAATGPGVTGF
PAGAPVTVMPLLWDGTCAACLAGHQHICQNLTFVGIDSPGALQQRWNVPAAIVLPLPAGL
DLRTAALVEPVAVAVHDVRRAELQIGDQVVVLGGGPIGVLIAVVARHAGARVVVAEIDAT
RRDLVAALGFDVLDPSDTGFAAEVERRTGGAGADVVFEVSGAAAAVRTATALAKVRGTIV
VVAIHAAPREVDLQRVFWRELRLLGARVYQRSDFERAIELLDGGVIPAQELITGVVPLEG
TADAMADLAAGRAMKILVDVAGQEQA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggagccgtcggccccggccgccggcgaggtgcagatcgcggtggcctactgcggtctg
tgcggcaccgacctgcacatcgcacacgggaacatggacgcccgggtgcgcaccccgctg
atcttcggccacgaggcgtcgggcaccgtcgccgctaccgggccgggcgtgaccggcttc
ccggccggcgctccggtcactgtgatgccgctgctctgggacggcacgtgtgccgcctgc
ctggccggccatcagcacatctgccagaacttgacgttcgtcggcatcgactcccccggt
gccctgcagcaacgctggaacgtgccggccgccatcgtgctgcccctgcccgcggggctg
gacctgcgcaccgccgccctcgtcgagccggtcgccgtcgccgtgcacgacgtgcggcgc
gccgagctgcagatcggcgatcaggtcgtggtcctgggcggcggcccgatcggcgtcctc
atcgccgtcgtggcccgccacgcgggggcccgggtcgtcgtggccgagatcgacgctacg
cgccgcgacctggtcgccgcgctcggtttcgacgttctcgacccgtccgataccggtttc
gccgccgaggtcgagcgccgcaccggcggggcgggtgccgacgtggtcttcgaggtctcc
ggtgccgccgccgcggtgcgcaccgccaccgccctggccaaggtgcggggcacgatcgtc
gtggtcgccatccacgcggccccccgcgaggtcgacctgcagcgggtcttctggcgcgag
ctgcgcctgctcggcgcgcgggtctaccagcgatccgacttcgagcgcgcgatcgagctg
ctggacggtggcgtcatccccgcgcaggagctgatcaccggtgtcgtgcccctggaaggc
accgccgacgccatggccgacctggcggccggacgggcgatgaagatcctggtggacgtc
gcggggcaggagcaggcatga

DBGET integrated database retrieval system