KEGG   Actinoplanes sp. N902-109: L083_5717Help
Entry
L083_5717         CDS       T02655                                 

Definition
(GenBank) putative polyketide synthase
Organism
actn  Actinoplanes sp. N902-109
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N PikAIV_N Epimerase GDP_Man_Dehyd Polysacc_synt_2 NmrA ACP_syn_III NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AGL19227
UniProt: R4LIN1
LinkDB All DBs
Position
complement(6594005..6608968)
Genome map
AA seq 4987 aa AA seqDB search
MPENDLVKALRESVKETARLRQRNSELIAAASEPIAIVSMGCRFAGGITGPEEFWSVVSQ
GTDVYTPFPDDRGWDLENLYDPDPDKPGTTYVKQGAFLRDAAQFDARFFGISPQEALAMD
PQQRQLLEVCWETVERAGIDPRSLRGSDTGVFAGVVHQDYAPDLAGAEHYLSLERALGSA
GGVASGRIAYCLGLEGPAVTVDTMCSSSLVAIHLASQALRRGECAMALAGGATVMATPGG
FVGFARQRGLAFDGRCKSFAAGADGSSWAEGAGVLLLERLSDARRNGHQVLAVIRGSAVN
QDGASNGLTAPNGPAQQRVIRRALQAAGLNPGDIDAVEAHGTGTSLGDPIEAQALFATYG
QDRDPGRPLLLGSVKSIIGHTQAASGVAGIIKTVLALRHGHLPATRYVDAPTPRVDWSSG
TVELLLEGRDWPAGERLRRSGVSSFGASGTNVHLILEEAPAATDAEAGQHPHGVLPFVLS
AQSPTALAEQARRLAAVVDDIPFGRFATTLATGRARLSRRAVVVARDPGELRTGLELLAA
GRTGGGAVAGTGPASDPGQVVFVFPGQGTQWAGMGRDLLDSSPVFAARIAECQEAFDPWL
DWSIADVLRGDGPGLARVDVVQPACFAVMLGLAAVWTAAGVTPDAVIGHSQGEIAAACVA
GALTLADAARVVILRSQAIADKLPRGGGMASVELAADEVAALIAPWGPRLEIAALNGPAA
VVVAGEAAALDELAAQVAGRDFRFKRIAVDYASHSHYVEAIEPVLRNDLAGLSPAAPGIP
FYSTTEVRWLTDADRLDAGYWYRNLRGTVRFEPAVRDLIAQDHRVFIELGAHPTLLAAIT
ATADAQAADVTATGSIRRDDGGPDRLLRSMAELFVRGVPIAWETLTPARTPEPAALPTYP
FDHQRYWITMPGTRTSPEALGQKSSDHPLLGAVVDLPQTDGLVLTSRLSLTTHPWLAGHR
IQDVVLVPGTVYVDLAVRAGDELGCGTLDELVIEAPLPLPPSGSVRIQVAVGGTDATGRR
PIEVYSSGEHTTGWTRHATGLLSATPPTGGTFDFTAWPPAGARREDIDGFYPALVARGYD
YGPAFAGLTAVWRRGDEIFAEAALPAGYGEDAGRFGIHPALLDAALHANAFHRRDDERNV
LPFAWNGLQLHATGARSLRVRVAPYGPDALSFEAADEHGAPVLSMESLVSLPVADLTAGP
APDSLWQLDWAPVSAAPTAEPGRWAQVTSTGDVARIALAGELGDEVPEAAVLDLTGGGPD
TEPLPLLHRVLAVVQAWLSEPVPDEVPLVVVTRGAAGPTGPVTDPPAAAVWGLVRAAQAE
NPGRFVLTDIEPGADRDRAVALALAAGEPQSAVRADTVHVPRLAPARLAERETPAPALAD
GTVLITGGTGVLGRLLARHLVERHGVRHLVLASRRGPAAEGVAELVEELGGRGAAVRVVP
CDLTDRAALTALLDSIPAEHPLTGLVHAAGVLDDSTIEGLDPRRLDAVFQPKAGVLRTLD
ELTRARPPAVFAAFSSAASVLGSAGQGNYAAANACTDALMTARRAAGLPAVSLAWGLWEP
ETAMTGTLTEVDRTRMSRAGVRPLPTGDALRIFDAAIGAGNDVLIPIRLDLGALRAAAAA
AGSVPPMYRGLVRPPRRAVRAAAPGSGGDLGRRLAGLSRPERTESLLGLIREEVATVLGL
GQPDPTLDTHRFGDIGFDSLTGVELRNRLSAVTAVKLPATLVFDYPTPQALAQYLLERLG
DDLSPEPEPAPAAVTVTGDDPVVVVGMACRLPGGIAGPDDLWRMVAEGRDGMSEFPQDRG
WDLGALFDPDPDHAGTSYARRGGFLHDAAEFDAALFGISPREALAMDPQQRLLLESTWEA
LESAGIDPLSLRGERVGVYTGMSIHDYLGSLTDVPAELEGYTTTATAGSVASGRVSYAFG
LEGPAMTVDTACSSSLVAIHLAAQALLGGECRMALAGGVAVMGSPVGVMGFSRARGLAAD
GRCKPFSADADGTVLSEGVGVVLLERLSDARREGHRVLAVVRGSAINQDGASNGLTAPNG
PAQQRVIRAALAAAGVAAADIDVLEAHGTGTTLGDPIEAQAIVATYGAGRSPENPLRLGS
VKSNLGHTQAAAGVVSVIKMVQAMRHETLPPTLYAAEATPHVDWSDGTVALLTDSCPWPA
GQRPRRAGVSSFGISGTNAHLILEQAPPATPEAATPEAAEPPAGVLPFVLSANSPAALAG
QARRLHAAVAAGAAPAATARTLFEARALLGHRAVVAASGTDGLLAGLDALGAGETAPGVA
AGEVIPAAAASVVFVFPGQGSQRPGMGRELYDAFPGYATAFDDVCAHLDAHLTGAVPLRD
AVFAEPGSPGAALLDETAYTQAALFATEVALFRLTESWGVRPALLVGHSIGEISAAYVAG
MLSLDDAALVVATRGRLMQNLPTGGAMAAVAATEDEVRPLLGAGADLAAVNHPGSVVLSG
TAEAVEAAAGRLRAEGRKVTALRVSHAFHSALMDPMLDDFRAALAGVTWQPARIPVVHLQ
DGDPAGADYWVEHVRRTVRFADGTRTALDRGGRLFVEMGPGTGLSAAMAHTGAGAEAAAV
CTPTLRDSSDEVRDVIAAMGELFVRGVPVDLSALLPAGGPRADLPTYAFDHKHYWLRTAG
SRASAAGLGLTPVDHPLLSAVAPLPDAGGLIGTARLTATSCRWLPDGGTLPPAAFVELAL
RAGDEAGCAALDTLTIDAPLVLGPADAVRLEVVVGAPDETGRRVLTIHSAPDGFGTWVRH
ATAVLSTAAPGAPEPDRRPWPPAAAGPADPGADHPQLVAVWRHGDEMLAEAALDDTDAEG
FQLDPRLLDAVTAGIGFAGRWDAVALHATGAGVLRARLTPSGDGTWTLRAADATGAPVLT
ATLHTTAPAVAAGAAPDAMFEVRWQEITRPEPAPSSVPCTPITGPAGIPATDAVFAPEPG
DDCLAGVLAVLQAWLRDAPAEARLVVLTREAVPAGATTVTDPDIGAAWGLVRAAQAENPG
RIVLLDAETGADTEAVVARALTLGEPQIAVRANAVLVPRLAPAGRLDHRPAPLDPTGTVL
VTGGTGSLGALVARHLAATRGVRHLLLVSRSGLAAPGAEALVADLSALGATVTVAACDVA
DRAAVAALLAGIPDEHPLTAVVHTAGILDDGLLEAMTPERLTAVLAPKATAARHLHELTR
AAGPVAFVAFSSAAGLLGSAGQANYAAANAYLDTLMAARHAAGLPGVSLSWGLWEQDGGI
TGHLGAVDRARMNRGGVLALEPAEALALFDAALDSDRAHLVPMKLDLAAARADAAAGGPV
QPLLGSLVRVRRRASAPAAGTDLAGSLAGRTPAEQESVLLALVRSRVALIMGYRSAEEIG
PDLPFQSAGLDSLTAVELRNRLGAGTGITLPTTVVFDYPTPRELARHLRDLLTGGDRQLA
AAPVLPAGPRDDIAVVGVGCRLPGGVDGPDDFWDLLANGRHAQSPFPADRGWDLGRIPVR
AGGFLPDAGGFDAGFFGISPREAVAMDPQQRILLEVVWEALENAGIDPFALRGTDVGVFV
GVMGQGYGMFGGDAESDGLRGTGGAVSVVSGRVSYVYGFTGPAVSVDTACSSSLVAMHLA
RQALRDGECSLAVVGGVTVMTTPGSFVEFAQNGGLATDGRCKAFAASADGTGNAEGVAVV
LLERLADARTNGHTVRALVRGSAVSQDGASNGLTAPNGPAQQRVIRRALAVAGLAPAEVD
AVEAHGTGTRLGDPIEAQALLATYGDRDSADPLWLGSVKSNVGHTQATAGVTSVIKMVLA
LEHEQLPATLHVDTPTPEVDWSAGTVRLLTESRPWPVRPDHPRRAGVSAFGLSGTNVHLI
LEEPPAVAEAPGEPHDEILPFVLSARDETRLAELAARLAGTVERSEIPLRDLAAALAHGR
SHHRVRSTVLAAGPGELVASLAGLAAGSPGDNVVSGTARPGTDVVFVFPGQGAQWIGMGS
ELLATSPDFRAWVRRCDDILAGYGIDWTVERAIGDDGDLSRVEVVQPATFVMMTGLAQLW
AAAGVVPDVVLGSSQGEIAAACVAGLLSLEDALHIVVLRSRLAAGLPAGGGTLVLGAGRE
RAGELIAGCGGRVEIGAVNGPSAVVLTGERGGIDAIAALAAEQGIWHRRLAADYASHSFL
VEELREPMLRALDGVGERPAQGLVPRCRFMSTVDVRWIGEDERLDAEYWFRNLRRPVLLD
PAIRMAAADARAIVEISTHPGLATSLLDVVADTGQPTAVLGTLRRGEGGRKRLLTAMAAA
FAAGLAVDWTSVVPVDGSWRRLCGMLPTYPFDHRHYWLKDQLTSGRSRDSGHPLVVAAAG
LGDGALVVARLDQAWIAAADPSAVLVELAIRAGDEVDCPVLEHLELIAPLPAEPGAELHV
RVGAEDPAGRRPLVVASVPGSVIAEGLVGPSTGGREQETGTQPYAEVSLPPAEQDAAEHY
GLHPLLLSAAAGLRATRWEGVTLHASGAAALRVRVTPVDGGVALDAVDEAGLPVLTVDRI
VAAATEPAATDEDLTLRWSGLPLEPAATPLSVAVLDDPAGLPELGGAGAAVFDVPAGKPA
EACAAVLGLAQMWLDEPDLEGHRLIVRTHRAVAVEPADTVEPAAAAVWDLVATVQAAYPG
RFLLVDTDTDTDTDIGTGAAGLAVLAGTHAEQVALRGGRALRPRLVPIGAGPAAARPDGT
VLVTGDPAVALGLAESDDRREVVLAWPGAGEDAPALPGVTVTACDVNDPAAVRHLLDTLG
PLTAVVLAMPAGEPVPFEELDADRLTAEVDARVAALEPWVEPAAGLPLSTVVVVTSTAAL
TGPADRVATAAADGAARALAARHPAGRVVALPPGSTAGAAVLAAGAPFRVPGRPDAWAAV
EPGHPVPFLLRGLVRPRRRRAAAAAQAGPDRAGWAHQLAEATGEQREQIVLGLIRDQLVE
VLRLDPGRPLDTRSGFFELGLDSLMAMDLSRRLSDRTGIALTPSGIFSHPTLSGLTKHVL
ETLDAAA
NT seq 14964 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaacgacctcgtcaaggcgctccgggaatcggtgaaggagaccgcgcgactg
cggcagcgcaacagcgaactgatcgccgcggccagcgaaccgattgccatcgtctcgatg
ggttgtcgtttcgccggcggcatcacgggcccggaggaattctggtccgtggtgtcgcag
gggaccgacgtctacaccccgttcccggacgaccggggctgggacctcgagaacctctac
gaccccgacccggacaagcccggcaccacgtacgtcaagcagggcgccttcctgcgggac
gcggcccagttcgacgcgcggttcttcggcatctccccgcaggaggcgctggcgatggac
ccgcagcagcggcaactgctcgaggtgtgctgggagaccgtcgaacgcgccgggatcgac
ccgcgcagcctgcgcggctcggacaccggcgtgttcgcgggcgtcgtccaccaggactac
gcacccgacctcgccggggcggagcattacctgagcctcgaacgcgcgctcggcagcgcg
ggcggcgtcgcctccggccggatcgcgtactgcctggggctggagggcccggccgtcacg
gtggacaccatgtgctcgtcgtcgctggtggcgatccacctggcgagccaggcgctgcgg
cggggcgagtgcgcgatggccctcgccggtggcgccacggtgatggcgacgcccggcggg
ttcgtcggcttcgcccggcagcgcgggctcgccttcgacgggcgctgcaagtcgttcgcg
gccggtgccgacggcagcagctgggccgagggcgccggggtgctgctcctcgagcggctc
agcgacgcccggcgcaacggccaccaggtcctcgccgtgatccggggctcggcggtcaac
caggacggcgcctccaacggcctgaccgcccccaacggtcccgcgcagcagcgggtgatc
cgccgggcgttgcaggcggccggcctgaacccgggtgacatcgacgcggtcgaggcacac
ggcaccgggacgtcgctcggcgacccgatcgaggcgcaggccctgttcgccacgtacggg
caggaccgcgacccggggcggccgctgctgctcggctcggtcaagtcgatcatcggccac
acccaggccgcgtccggcgtggccgggatcatcaagacggtgctcgcgctgcggcacggc
cacctgcccgccacccggtacgtcgacgcgcccaccccccgggtcgactggtcgtccggc
accgtcgagctgctgctcgaagggcgcgactggccggccggcgagcgactccggcgatcc
ggtgtctcgtcgttcggcgccagcggcaccaatgtccacctgatcctggaggaggcgccg
gccgccaccgacgcggaggccgggcagcacccgcacggcgtcctgccgttcgtgctttcc
gcccagtcacccaccgccctggccgaacaggcccgccgcctcgccgcggtggtggacgac
ataccgttcggccgcttcgccaccaccctggccaccggtcgcgcccggctgagccgccgg
gccgtggtcgtcgcgcgtgaccccggtgagctgcgcaccggcctggagctgctggccgcc
gggcgtaccggcggcggcgccgtggcgggaaccggcccggcaagcgacccggggcaggtc
gtcttcgtcttcccgggccagggcacccagtgggccggcatgggccgcgacctgctggac
agctcgcccgtcttcgccgcccggatcgccgagtgccaggaggcgttcgacccgtggctc
gactggtcgatcgccgacgtcctgcgcggcgacggccccggcctcgcccgcgtcgatgtc
gtccaaccggcctgcttcgcggtgatgctcgggctggccgcggtctggaccgccgccggg
gtcacgcccgacgcggtgatcggccactcgcagggcgagatcgcggcggcctgcgtggcc
ggggcactgaccctggccgacgccgcccgcgtcgtgatcctgcgcagccaggccatcgcc
gacaagctgccccgcgggggtggcatggcctccgtcgaactggccgccgacgaggtcgcc
gcgctgatcgctccgtggggtccgcggctggagatcgcggcgctgaacgggccggccgcc
gtcgtcgtcgccggggaggcggccgcgctcgacgagctcgccgcccaggtggccgggcgg
gacttccggttcaagcggatcgccgtcgactacgcctcgcacagccactacgtcgaggcg
atcgaaccggtcctgcgcaacgacctggccggcctgtccccggccgcgccgggcatcccg
ttctactccaccaccgaggtccgctggctgaccgacgccgaccgtctcgacgccgggtac
tggtaccgcaacctgcgcggaaccgtccgcttcgagcccgccgtccgcgacctcatcgcc
caggaccaccgcgtgttcatcgagctcggcgcccacccgacgctgctcgccgcgatcacc
gcgacggccgacgcacaggcggccgacgtcaccgccaccggctcgatccgccgcgacgac
ggcggcccggaccggctgctgcggtcgatggccgagctgttcgtccggggggtaccgatc
gcctgggagaccctgaccccggcccgtacgccggaaccggccgcgctgccgacgtacccg
ttcgaccaccagcgctactggatcacgatgccggggacccggacgagccccgaggcgctg
ggccagaagtccagcgaccacccgctgctcggcgccgtggtggatcttccccagaccgac
ggcctggtcctcacctcccggctgtcgctgaccacccacccctggctggccgggcaccgc
atccaggacgtcgtgctggtgcccggcaccgtctacgtcgacctcgccgtacgcgccggg
gacgaactcggctgcggcaccctcgacgagctcgtcatcgaggcgcccctgccgctgccc
ccgagcggcagcgtccgcatccaggtcgccgtcggcggcacggacgccaccggtcgccgc
ccgatcgaggtctacagcagcggcgagcacaccaccggctggacccggcacgccaccggt
ctgctctccgcgaccccgccgaccggtggcaccttcgacttcaccgcgtggcccccggcc
ggtgcgcggcgggaggacatcgacggtttctaccccgccctggtcgcccgtgggtacgac
tacgggcccgcgttcgccggcctcaccgcggtgtggcggcgcggcgacgagatcttcgcc
gaggcggcgctgccggccgggtacggcgaggacgccggccggttcggcatccaccccgcg
ctgctcgacgccgcgctgcacgccaacgcgttccaccgccgcgacgacgagcgcaacgtc
ctgccgttcgcctggaacgggctgcagctgcacgccaccggggcgcggtcgctgcgcgta
cgggtcgccccgtacggccccgacgcgctgtccttcgaagctgccgacgagcacggtgcc
ccggtcctgagcatggaatccctggtgtcgctgccggtcgccgacctcaccgccggacct
gcgccggactcgctgtggcagctggactgggcgccggtgtccgctgcgccgacggctgag
ccgggccgctgggcgcaggtcacctccaccggcgacgtcgcccggatcgcgctggccggg
gaactcggcgacgaggtgcccgaagccgccgtgctcgacctcaccggcggcggtccggac
accgagccgctgcccttgctgcaccgggtgctcgccgtcgtacaggcatggttgtccgaa
cccgtcccggacgaggtgccgctggtcgtcgtcacccgcggcgcggccggacccaccggc
ccggtcaccgacccgccggccgccgcggtgtggggtctggtccgggccgcgcaggccgag
aaccccggccggttcgtgctcaccgacatcgagccgggcgccgaccgggaccgggctgtc
gcgctcgcgctggccgccggggaaccccagtcggccgtccgcgcggacaccgtccacgtt
ccccggctggccccggcccggctggccgagcgcgagacgccggcgccggcgctggccgac
ggcaccgtgctgatcaccggcgggaccggcgtgctcggccggctgctggcccgccacctg
gtcgagcggcacggtgtacgccacctcgtgctcgccagccggcggggcccggccgccgag
ggcgtggccgagctggtcgaggagctgggcgggcggggagccgccgtccgtgtcgtaccg
tgcgacctgaccgatcgcgccgccctgaccgccctgctcgacagcatccccgccgagcac
ccgctcaccgggctggtgcacgcggccggggtgctcgacgacagcacgatcgagggcctg
gacccgcgccgcctcgacgccgtcttccagcccaaggccggggtgctgcgcacgctcgac
gagctgacccgggcccggccaccggcggtcttcgccgccttctcgtccgccgcgagcgtt
ctcggctcggccggccagggcaactacgccgcggccaacgcctgcacggacgcgctcatg
acagcccgccgggcggccggactgcccgctgtgtcgctggcctggggcctgtgggagccc
gagacggcgatgacgggcaccctcaccgaggtcgaccggacccggatgagccgggccggc
gtccgcccgctgcccaccggcgacgccctgcgcatcttcgacgccgccatcggcgccggc
aacgacgtgctgatcccgatccgcctcgacctcggtgcgctgcgcgccgccgcagccgcc
gccggatcggtaccgccgatgtaccgcgggctcgtccggccgccgcgccgcgccgtccgg
gccgccgcgcccggctcgggcggcgacctgggccgccgcctggccgggctgtcgcgcccg
gagcgcaccgagtcgctgctgggcctgatccgggaggaggtcgccaccgtcctgggcctc
gggcagcccgatccgaccctcgacacgcaccgcttcggcgacatcggcttcgactcgctg
accggggtcgaactgcgcaaccggctgtcggcggtcaccgccgtcaagctgcccgccacc
ctggtcttcgactacccgaccccgcaggcgctcgcccaatacctgctggaacgtctgggg
gacgacctgtccccggagcccgagccggcccccgccgcggtcaccgtgaccggcgacgac
ccggtggtcgtcgtcggcatggcgtgccgcctgcccggggggatcgccggacccgacgac
ctctggcggatggtcgccgagggccgcgacggcatgtcggagttcccacaggaccggggc
tgggacctgggcgccctgttcgatcccgacccggaccacgcgggcacgtcgtacgcccgg
cgcggtggtttcctgcacgacgccgcggagttcgacgccgccctgttcgggatctccccg
cgcgaggcgctggcgatggacccgcagcagcggctgttgctggagagcacctgggaggcg
ctggagtcggccggcatcgacccgttgtcgctgcgcggcgaacgggtcggcgtctacacc
ggcatgtccatccacgactacctgggttcgctgaccgacgtaccggccgaactcgagggc
tacaccacgacggccaccgcgggcagcgtcgcgtccggccgggtgtcgtatgcgttcggc
ctcgagggccccgcgatgacggtggacaccgcctgctcgtcgtcgttggtggcgatccac
ctggcggcccaggccctgctcggcggcgaatgccggatggcgctcgccgggggcgtggcg
gtgatgggttccccggtcggggtcatgggcttctcccgggcgcggggcctggccgccgac
ggccgctgcaagccgttctcggccgatgcggacggcacggtgctctccgagggcgtcggc
gtggtgctgctcgaacggctgtcggacgcgcggcgcgagggacaccgggtactcgccgtc
gtgcgggggtcggcgatcaaccaggacggcgcctcgaacgggctcaccgccccgaacggc
ccggcccagcagcgggtgatccgggcggccctcgccgccgccggggttgccgccgccgac
atcgacgtgctggaggcgcacggcaccggcaccacgctcggcgaccccatcgaggcgcag
gcgatcgtcgcgacgtacggcgccggccggtcgcccgagaacccgctgcggctgggttcg
gtgaagtcgaacctgggccacacccaggccgcggccggggtggtctcggtcatcaagatg
gtgcaggcgatgcggcacgagacgctcccgccgaccctgtacgccgccgaggccaccccg
cacgtcgactggtccgacggcacggtggccctgctgaccgacagctgcccgtggcccgcc
gggcagcgaccccgccgggccggggtctcctcgttcggcatcagcggcaccaacgcccac
ctgatcctggaacaagccccaccggccacccctgaggcggccacccctgaggcggccgag
cccccggccggggtcctgccgttcgtcctgtccgcgaacagcccggccgcgctggccggg
caggcccgtcgcctgcacgccgcagtcgccgccggggccgccccggccgccaccgcgcgg
accctgttcgaggcccgggccctgctcggccaccgggccgtcgtcgcggcgtccggtacg
gacgggttgctggccggcctcgacgccctcggtgccggcgagaccgcgccgggtgtcgcc
gccggggaggtcatcccggccgccgccgcgtcggtggtgttcgtgttccccggtcagggc
tcccagcgtccgggcatgggccgcgagctgtacgacgcgtttcccgggtacgccacggcg
ttcgacgacgtctgcgcccacctcgacgcccacctgaccggcgcggtcccgctgcgcgac
gccgtgttcgccgagccgggcagccccggggcggcgctgctcgacgagaccgcctacacc
caggcggccctgttcgcgaccgaggtcgcgctgttccggctgaccgagtcgtggggcgtg
cgcccggccctgctcgtcgggcactccatcggcgagatcagcgcggcgtacgtcgccggg
atgctctcgctggacgacgcggccctcgtcgtggcgacccgcggccggctcatgcagaac
cttccgaccggcggggcgatggccgcggtggcggcgaccgaggacgaggtacgcccgctg
ctcggcgccggtgccgacctcgctgcggtcaaccacccggggtccgtcgtgctgtcgggc
accgcggaggcggtggaggccgctgccgggcggctgcgcgccgagggacgcaaggtcacc
gcgctgcgcgtctcgcacgccttccactcggcactgatggacccgatgctcgacgacttc
cgggcggccctcgccggcgtcacctggcagcccgcccgcatcccggtcgtccacctgcag
gacggcgacccggccggcgccgactactgggtcgagcacgtccgccgtaccgtacggttc
gccgacggcacccgcaccgcgctcgaccgcggcggacgcctgttcgtcgagatgggtccc
gggaccgggctgtccgcggcgatggcccacaccggcgccggagcggaggccgccgcggtc
tgcacgccgaccctgcgcgacagcagcgacgaggtgcgcgacgtcatcgcggcgatgggt
gagctgttcgtccgcggcgtgccggtcgacctgtcggcgctgctgcccgccggtggcccc
cgagcggatctgccgacgtatgcgttcgaccacaagcactactggctgcggaccgccggg
tcccgcgcgagcgctgccgggctcggtctcaccccggtcgaccacccgctgctgtccgcc
gtcgccccgctgcccgacgcgggcggcctgatcgggaccgcccggctgacggcgacgtcc
tgccggtggctgccggacggtggcacgctaccgccggcggcgttcgtcgagctggccctg
cgcgccggtgacgaggccggctgcgccgcgctggacaccctgaccatcgacgcgccgctg
gttctcggtcccgctgacgccgtccgcctggaagtggtcgtgggggcgccggacgagacc
ggccggcgggtgctgaccatccacagtgcaccggacgggttcgggacctgggtgcggcac
gccaccgccgtgctgtcgaccgccgcgccgggcgcacccgagcccgatcgccgcccctgg
cccccggccgcggccgggcccgccgaccccggcgccgatcacccgcagctggtggcggtg
tggcggcacggcgacgagatgctggccgaggcggctctcgacgacaccgacgcggagggc
ttccagctcgacccgcgcctgctcgacgcggtgacggccgggatcggtttcgccggccgc
tgggacgccgtcgccctgcacgccaccggcgccggtgtgctgcgagcccggctcacccct
tccggcgacggcacctggacactgcgggccgccgacgcgaccggtgccccggtgctgacc
gcgaccctgcacaccaccgctccggccgtcgccgcgggggccgccccggacgccatgttc
gaggtgcgctggcaggagatcacccggcccgagccggctccctcgtcggttccctgcacc
ccgatcaccggcccggccgggattcccgccacggacgccgtgttcgcgcccgaaccgggg
gacgactgcctggccggcgttctcgccgtgctccaggcgtggctgcgcgacgctcccgcc
gaggcgcgcctggtggtcctgacccgcgaggcggtacccgcgggcgcgacgacggtcacc
gatccggacatcggggcggcgtggggtctggtccgggccgcccaggccgagaacccgggc
cggatcgtgctgctcgacgccgagaccggtgcggacaccgaggccgtcgtcgcgcgcgcc
ctgactctcggggaaccccagatcgccgtccgcgcgaacgcggttctcgtaccccggctg
gccccggccggtcggctggaccaccggccggccccgctcgaccccaccggcaccgtcctg
gtcaccggcggcaccggatccctcggcgccctggtggcgcggcatctggcggccacccgg
ggcgtccggcacctgctgctcgtcagccgcagcgggctggcggcccccggcgccgaggcg
ctggtcgccgacctgtccgccctgggcgcgacggtgaccgtggccgcctgcgacgtggcc
gaccgggccgccgtggccgccctgctggccggcatcccggacgagcacccgctgaccgcc
gtcgtgcacaccgcgggcatcctcgacgacggcctgctcgaggcgatgaccccggaacgg
ctcaccgcagtcctggcgcccaaggcgacggcggcgcggcacctgcacgaactgacccgt
gccgccgggccggtcgcgttcgtcgcgttctcctcggcggcggggctgctcggatcggcc
ggacaggccaactacgccgccgccaacgcctatctcgacaccctcatggcggcccgccac
gccgccggtcttcctggagtctcgctgtcgtgggggctgtgggagcaggacggcgggatc
accgggcacctcggcgccgtcgaccgcgcgcggatgaaccggggcggcgtactcgccctg
gaacccgccgaggccctggcactgttcgacgcggccctcgacagcgaccgcgcccacctc
gtaccgatgaagctcgatctcgccgccgcccgggccgacgccgcggccgggggcccggtg
caaccgctgctcggctcgctggtccgggtacgccgccgggcgtcggcccccgcggccggc
accgacctggccgggtcgctcgccggtcggacccccgccgagcaggagtccgtgctgctc
gccctggtgcgctcgcgcgtcgcgctgatcatgggctaccgctcggccgaggagatcggt
cccgatctgccgttccagtccgccgggctggactcgctgaccgccgtcgagctgcgcaac
cggctcggcgccggcaccgggatcacgctgcccacgaccgtcgtcttcgactacccgacg
ccccgggaactcgcccgccacctgcgcgacctgctgaccggcggcgaccggcagctcgcg
gcggcacccgtgctgccggccggaccgcgggacgacatcgccgtcgtcggggtcggctgc
cggctgccgggaggcgtcgacggtccggacgacttctgggacctgctggccaacggtcgg
cacgcgcagtcgccgttcccggccgaccggggctgggacctcgggcggatcccggtccgg
gccggtggcttcctgcccgacgccgggggcttcgacgccgggttcttcggtatctcccca
cgcgaagcggtggcgatggacccgcagcaacgcatcctgctcgaagtcgtctgggaggcg
ctcgagaacgccggcatcgacccgttcgccctgcgcggcaccgacgtcggcgtgttcgtg
ggggtgatgggccagggctacgggatgttcggcggcgacgccgagtccgacggcctgcgc
ggcaccggcggcgccgtctcggtggtctccggccgggtgtcctacgtgtacgggttcacc
ggccccgcggtctcggtggacaccgcctgctcgtcgtccctggtcgccatgcacctggcc
cggcaggcgctgcgcgacggggagtgctcgctggcggtcgtcggcggcgtcacggtgatg
accacgcccggctcgttcgtggagttcgcccagaacggcgggctcgccacggacgggcgc
tgcaaggcgttcgcggcgtcggccgacggcaccggcaacgccgagggcgtcgcggtcgtg
ctgctggaacggctggccgacgcgcgtaccaacgggcacaccgtgcgggctctggtccgc
ggatccgcggtcagccaggacggcgcctcgaacggtctcaccgcccccaacggtccggcc
cagcaacgggtcatccgccgcgcgctggcggtggccgggctcgctccggccgaggtcgac
gccgtcgaggcgcacggcaccggcacccgcctcggcgacccgatcgaggcccaggcgttg
ctcgccacctacggcgaccgggacagcgccgacccgctgtggctcggctcggtcaagtcc
aacgtcgggcacacccaggccaccgccggcgtgaccagcgtgatcaagatggtgctggcg
ctggagcacgagcagctcccagcgacactgcacgtggacaccccgacccccgaggtcgac
tggtcggccgggacggtccggctgctcaccgaatcacggccctggccggtacgcccggac
cacccccgccgtgccggggtgtccgccttcggcctcagcggcaccaacgtgcacctcatc
ctcgaggagccgcccgccgtcgccgaggcccccggggaaccgcacgacgagatcctgccg
ttcgtgctctcggcccgtgacgagacccggctggcggagctcgccgcgcgcctcgccggc
accgtcgagcggtcggagatcccgctgcgggacctggcggccgccctcgcgcacggccgt
agccaccatcgggtgcggtcgacggtcctcgccgccggccccggcgagctggtcgcgagc
ctggccggcctggccgcgggcagcccgggcgacaacgtcgtgagcggcaccgcccggccc
ggcaccgacgtggtgttcgtcttccccggccagggcgcgcagtggatcggcatgggaagc
gagctcctggccacctcgcccgacttccgcgcctgggtgcgccgctgcgacgacatcctc
gccggctacgggatcgactggacggtcgagcgggcgatcggcgacgacggggacctgtcc
cgggtcgaggtcgtgcagcccgcgacgttcgtcatgatgaccggcctcgcccagctctgg
gccgcggccggggtggtgccggacgtcgtgctcggatcgtcgcagggcgagatcgccgcc
gcctgcgtggccgggctgctgtcgctggaggacgccctgcacatcgtggtgctgcgctcc
cggctcgcggccggtctgcccgccggcgggggcacgctggtgctgggcgccggacgcgag
cgggccggcgagctgatcgccgggtgcggcggccgggtggagatcggagcggtgaacggg
ccgtcggcggtggtgctgaccggtgagcgcggtggcatcgacgccatcgccgccctggcc
gccgagcagggcatctggcaccgtcgcctggcggcggactacgcgtcgcactcgttcctc
gtcgaggagttgcgcgagccgatgctgcgcgcgctcgacggtgtcggcgagcgccccgca
cagggcctcgtaccccggtgccggttcatgtccacggtggacgtccgctggatcggggag
gacgagcggctcgacgccgagtactggttccggaacctgcgccggccggtgttgctcgac
cccgccatccggatggccgcggccgacgcgcgagccatcgtcgagatctccacccatccc
gggctcgccacctcgctgctggacgtcgtggccgacaccgggcagcccactgcggtgctc
ggcacgctgcgccgcggcgagggtggccgcaagcgactgctgaccgcgatggccgccgcg
ttcgccgccgggctggcggtggactggacgagcgtggtgccggtcgacggctcctggcgg
cggctctgcgggatgctgcccacctatccgttcgaccatcgccactactggctgaaggac
cagctcacctccgggcgttcgagggactcggggcacccgctggtggtcgcggcggccggt
ctgggcgacggtgctctcgtggtggcccggctggaccaggcctggatcgccgcggccgac
ccgtcggccgtcctggtcgaactcgccatccgcgccggggacgaggtggactgcccggtc
ctggagcacctggagctgatcgccccgctgccggccgagcccggcgccgagctgcacgtg
cgggtgggtgccgaggatccggcgggccgccggccgctggtcgtcgcgtcggtgccgggg
tcggtgatcgccgaggggctggtcggcccgagcaccggaggccgggagcaggagaccggg
acgcaaccgtacgccgaggtctcgctgcctcccgccgaacaggatgcggccgagcactac
ggcctgcacccgctgctgctgagcgccgccgccggcctgcgggcgacccggtgggagggg
gtgaccctgcatgcctcgggggccgcggcgctgcgtgtccgcgtgacaccggtcgacggc
ggcgtcgccctggacgccgtggacgaggcgggactgccggtcctcaccgtcgaccggatc
gtggccgccgcgacagaacccgccgcgacggacgaggacctgaccctgcggtggtccggc
ctcccgctcgaacccgcggccacgccgttgtccgtggcggtgctcgacgaccccgccggg
ttgcccgagctgggtggggccggcgcggccgtgttcgacgtcccggccgggaaaccggcg
gaggcgtgcgccgcggtgctcggcctggcccagatgtggctcgacgaaccggatctcgag
ggccaccgcctgatcgtccgtacgcaccgagcggtcgccgtggagccggccgacaccgtg
gaacccgccgccgcggcggtctgggacctggtcgccaccgtccaggcggcctacccgggc
cggttcctgctggtcgacaccgacaccgacaccgacaccgatatcggcaccggcgcggct
gggcttgctgtgctcgccgggacgcacgccgagcaggtggcactccgcggtggccgcgcc
ctgcgcccgcgactggtcccgatcggcgccggaccggctgcggcccgcccggacggcacg
gtactggtgaccggcgacccggctgtggccctcggcctggccgagtcggacgaccggcgc
gaggtcgtcctggcgtggccgggggcgggcgaggacgcaccggctctccccggcgtgacc
gtcacggcctgcgacgtgaacgacccggccgccgtccggcacctgctggacaccctgggc
ccgctcaccgccgtcgtgctcgcgatgcccgccggggaaccggtcccgttcgaggagctg
gacgccgaccggctgaccgccgaggtcgacgcccgggtggcggccctcgaaccctgggtg
gaaccggccgccggactgccgctcagcaccgtcgtggtcgtcacctcgaccgccgcgctg
accggcccggccgatcgggtggccaccgcggccgccgacggagcggctcgcgccctggcg
gcccggcaccccgccggccgcgtggtcgccctcccgcccggttccaccgctggtgccgcc
gtgctcgctgcgggtgcgccgttccgggtgccggggcggcccgatgcctgggccgccgtc
gaacccggccacccggtccccttcctgctgcgcggtctggtgcggccgcgccggcggcga
gcggccgcagcggcgcaggccggcccggaccgggccggttgggcgcaccagctggccgaa
gcgaccggtgagcagcgggaacagatcgtgctcgggctgatccgcgaccagctcgtcgag
gtgctgcggctggacccgggccgcccgctggacacccgcagcggcttcttcgagctcggc
ctggactccctgatggcgatggacctgtcccgccggctcagcgaccggaccggcatcgcc
ctcaccccgtcggggatcttcagccacccgacgctgtccgggctcaccaagcacgtcctg
gaaaccctcgacgccgccgcatga

DBGET integrated database retrieval system