KEGG   Actinoplanes sp. N902-109: L083_6653Help
Entry
L083_6653         CDS       T02655                                 

Gene name
ligC
Definition
(GenBank) ATP dependent DNA ligase
Organism
actn  Actinoplanes sp. N902-109
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C LZ_Tnp_IS481
Motif
Other DBs
NCBI-ProteinID: AGL20163
UniProt: R4LNW6
LinkDB All DBs
Position
7612459..7613526
Genome map
AA seq 355 aa AA seqDB search
MDLPINPPVKPMLAKPVADIPAGQLYEPKWDGFRSIIFRDGAEVEIGSRNEKPMTRYFPE
VVEAVLANFPERAVIDGEVIVADTERNTLDFEALQQRIHPAASRVKLLSGTTPAAFVAFD
LLALGDEDLTVRPFAERRARLVEALADAKPPVHVTPATDDLETARRWFAEFEGAGLDGLI
AKAKDLGYEPDKRVMAKIKHKRTADCVVAGYRVHKSADNRIGSLLLGLYDDRDVLVSVGV
IGSFPMAVREELFIELQHLVTTFDEHPWNWAAHESGERTPRKNEVSRWNTGKDLSFVPLR
PERVVEVRYDYMEGERFRHTAQFERWRPDREPRTCTYEQLERPVRFQLADVLTSR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccgatcaacccgcccgtcaaaccgatgctcgccaagccggtcgccgacatc
ccggcggggcagctctacgagcccaagtgggacggcttccgctcgatcatcttccgggac
ggcgcggaggtggagatcggcagccgcaacgagaagccgatgacccgctacttccccgag
gtcgtcgaggccgtgctggccaacttcccggagcgcgcggtgatcgacggcgaggtgatc
gtcgccgacaccgagcgcaacacgctggacttcgaggcgctgcaacagcgcatccacccc
gccgcgagccgggtcaaactgctcagcgggaccaccccggcggccttcgtcgcgttcgac
ctgcttgcgctcggtgacgaggatctgacggtacggccgttcgccgagcgccgggcgcgc
ctggtcgaggcgctggccgacgcgaagccgccggtgcacgtcacaccggccaccgacgac
ctggagaccgcgcgccgctggttcgccgagttcgagggcgccggtctggacgggctgatc
gccaaggccaaggatctgggctacgaaccggacaagcgggtcatggccaagatcaagcac
aagcgtacggccgactgcgtggtcgccggctaccgcgtgcacaagtccgcggacaaccgc
atcggctcactgctgctgggtctgtacgacgaccgcgacgtgctggtgtcggtcggggtg
atcggctcgttcccgatggcggtgcgcgaggagctgttcatcgagctgcagcacctggtc
accacgttcgacgagcacccgtggaactgggccgcgcacgagtccggcgagcgtacgccg
cgcaagaacgaggtgagccgctggaacaccggcaaggacctgtcgttcgtcccgttgcgc
ccggagcgcgtggtcgaggtgcgctacgactacatggagggcgaaaggttccgccacacc
gcgcagttcgagcgctggcggcccgaccgggagccccgcacctgcacgtacgagcagctc
gagcggccggtccggttccagctcgcggacgtgctgacgagccgatga

DBGET integrated database retrieval system