KEGG   Actinoplanes sp. N902-109: L083_6830Help
Entry
L083_6830         CDS       T02655                                 

Definition
(GenBank) ABC transporter-like protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
actn  Actinoplanes sp. N902-109
Brite
KEGG Orthology (KO) [BR:actn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:actn02000]
    L083_6830
Transporters [BR:actn02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    L083_6830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 MukB SMC_N SbcCD_C DUF3584 AAA_15 AAA_30
Motif
Other DBs
NCBI-ProteinID: AGL20340
UniProt: R4LYL1
LinkDB All DBs
Position
7796192..7797076
Genome map
AA seq 294 aa AA seqDB search
MLSVDAISRSFGDRQVLKDVSFDVGAGRMTGFVGANGAGKTTTMRIMLGVLGADSGEVRW
QDRPLTRELRQRFGYMPEERGLYPKMTIADQISYLGRLHGMTAADARRSTDALLERLSLT
DRAGDMVEKLSLGNQQRVQIAAALVHEPEVLVLDEPFSGLDPLAVDVVVGVLRDRAAAGA
PVLFSSHQLDVVERLCDDLVIIADGSIRAAGSRQQLRASHALPRFRIETDGDAGWLRDQP
GVTLIELDGGQAVFDLAPGTDDQDLLRTALARGPVRSFGPVSPSLAEIFREVSQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagtgtcgatgccatcagccgcagtttcggcgaccgccaggtgctcaaggacgtc
tcgttcgacgtgggggcgggccggatgaccggcttcgtcggcgccaacggggccggcaag
accaccaccatgcgcatcatgctcggggtgctcggcgccgactccggcgaggtgcgctgg
caggaccggccactcacccgcgagctgcggcagcgcttcggctacatgccggaggaacgc
ggcctctatcccaagatgaccatcgccgaccagatcagctatctcggccgcctgcacggc
atgaccgcagccgatgctcgccggagcaccgatgccctgctcgaacggctcagcctgacc
gaccgcgccggcgacatggtggagaagctgtcgctcggcaaccagcaacgggtgcagatc
gcggccgcgctggtgcacgagcccgaggttctcgtgctcgacgagccgttctccggcctc
gacccgctggctgtcgacgtcgtggtgggggtgctgcgcgaccgggcggcggcgggcgct
cccgtgctgttctccagccaccagctcgacgtcgtggaacggctttgtgacgacctggtc
atcatcgccgacggttcgatccgcgccgccggcagccggcagcagctccgggccagccat
gcgctcccacgcttccgcatcgagacggacggcgacgccggttggctgcgcgaccagccg
ggggtgacactgatcgagctcgacggcggccaggccgtcttcgacctggcgcccggcacc
gatgatcaagaccttctgcgtacggccctcgcccgcggcccggtgcgctcgttcgggccc
gtctcaccctcgcttgccgaaatcttccgggaggtcagccagtga

DBGET integrated database retrieval system