KEGG   Actinoplanes sp. N902-109: L083_7204Help
Entry
L083_7204         CDS       T02655                                 

Definition
(GenBank) nickel-containing superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
actn  Actinoplanes sp. N902-109
Brite
KEGG Orthology (KO) [BR:actn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L083_7204
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     L083_7204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AGL20714
UniProt: R4LYD3
LinkDB All DBs
Position
8193053..8193457
Genome map
AA seq 134 aa AA seqDB search
MRLPRFFTPRTVVSAHCDLPCGVYDPAQARIEAESVKAIAEKYQANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPQLNQLFNEATKLAGASGAKGSMDPAVGDQLLAK
IEEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccgcgtttcttcacgccgcgcactgtggtcagcgcgcactgcgacctgccg
tgcggggtttacgacccggcgcaggcccgcatcgaggcggagtcggtgaaggccatcgcc
gagaagtaccaggcgaacaccgaccccgagttccgcacccgcgccatcctcatcaaggag
cagcgcgccgagctggtcaagcaccacctgtgggtgctctggacggactacttcaaggct
ccgcacttcgagaagtacccgcagctcaaccagctgttcaacgaggccaccaagctggcc
ggggcgtccggcgccaagggttcgatggacccggccgtcggcgaccaactcctggccaag
atcgaggagatctccaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system