KEGG   Actinoplanes sp. N902-109: L083_7324Help
Entry
L083_7324         CDS       T02655                                 

Definition
(GenBank) radical SAM domain-containing protein
Organism
actn  Actinoplanes sp. N902-109
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM B12-binding
Motif
Other DBs
NCBI-ProteinID: AGL20834
UniProt: R4LYR1
LinkDB All DBs
Position
complement(8313601..8315073)
Genome map
AA seq 490 aa AA seqDB search
MTDVRTLLVDLNNLSRYPTLGVGYLVAALRGAGMTVEVLSPLLHGVPPYVRERPQNLTTH
VKQRALFAMHPFVTPMRDQLRGRYLAQRRRANPRVLHETRTAFEQRRPDVLLLSAYLDHR
PSVEALCELAAGAGVPVVLGGPAFNDPAVSRDWLQIRGLTAIVGAEADFSLPGIVADLLD
GNDLTRHHGVFLPDGRQGPPAPPLADLAQLPVPDFTDFPWHFYRTAVVPVMTGRGCSWGK
CLFCSDIETANGRTFRSRPLSAVMAEIAVQSERHRAKQVAFLDIKLNGDLDMWRGIAEQF
QSYVPGGTWVGTVHVQARGDNGLGRDDLQRAYDSGMRRISCGLETGSQRVNDRMAKGTEI
ARTSQFIKDAHAAGLSVRTTMMLGYPGETSHDVAQTHRFLSEHEHMLDRISMSPFKAIPG
TRFARRHDDDPTRFPDLRDLKWEAGQATATFRHEPPAPRAYRKERAKVLNLVHRINSRDL
RNQALEFDGV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtcagaacgctcctggtcgacctcaacaatctgtcgcgctatcccaccctc
ggggttggttaccttgttgccgcgttgcgcggtgccggtatgacagtcgaagtgctgtca
ccattgctccacggtgtgccgccatacgtcagggaacggccgcagaacctcaccacacac
gtcaagcagcgggctctcttcgccatgcacccgttcgtcacgccgatgcgggaccagttg
cgcggccggtatctggctcagcggcgacgggccaatcccagggtgctgcacgagacgaga
accgcgttcgagcagcgccgcccggatgttctgctgctctccgcatatctcgaccaccgc
ccgtccgtcgaggcgctctgcgagttggcggccggtgcgggcgtgccggtcgtcctcggt
gggccggccttcaacgacccagcggtgagccgggactggctgcagatccggggtctcacc
gcgatcgtcggggccgaagcggacttctcgctgcccggcatcgtggctgacctgctcgac
ggcaacgatctcaccaggcaccacggagtgttcctaccggacgggcggcaaggtccaccg
gcaccgccactcgctgacctggcccagctgccggttccggacttcaccgacttcccgtgg
cacttctaccggacggcggtggtgccggtgatgaccggccggggctgcagctggggaaag
tgcctgttctgcagcgacatcgagacggcgaacgggcggacgttccggagcaggccgctg
tcggcggtcatggccgagatcgcggtgcagtccgagcgtcaccgggccaaacaggtggcc
ttcctcgacatcaagctcaacggcgacctggacatgtggcggggaatcgccgagcagttc
cagtcgtacgtgcctggtggcacctgggtcgggacagtgcacgtccaggcccgcggggac
aacggtctcggccgggacgacctgcagcgagcctacgactcggggatgcggcgtatcagt
tgcggcctggagacgggcagccagcgggtcaacgaccggatggcgaagggtacggaaatt
gcccgcacctcgcagttcatcaaggacgcccacgccgccggcctcagtgtgcggaccacg
atgatgctcggctatcccggtgagaccagccacgacgtagcccagacccaccgctttctg
agcgagcacgaacacatgctcgaccggatcagcatgagcccgttcaaggccattcccggc
acccgcttcgcgcgccggcacgacgatgacccgacccgtttcccggatctgcgggatttg
aagtgggaggcgggccaggccaccgccaccttccggcacgagccaccggccccgcgcgcc
taccggaaggagcgagcgaaggtcctcaatctggtgcaccgcatcaacagccgtgacctg
aggaaccaggcgctcgagttcgacggcgtctga

DBGET integrated database retrieval system