KEGG   Actinomyces sp. oral taxon 897: C3V41_01275Help
Entry
C3V41_01275       CDS       T05399                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00010  Glycolysis / Gluconeogenesis
acto00030  Pentose phosphate pathway
acto00051  Fructose and mannose metabolism
acto00052  Galactose metabolism
acto00680  Methane metabolism
acto01100  Metabolic pathways
acto01110  Biosynthesis of secondary metabolites
acto01120  Microbial metabolism in diverse environments
acto01130  Biosynthesis of antibiotics
acto01200  Carbon metabolism
acto01230  Biosynthesis of amino acids
acto03018  RNA degradation
Module
acto_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3V41_01275
   00030 Pentose phosphate pathway
    C3V41_01275
   00051 Fructose and mannose metabolism
    C3V41_01275
   00052 Galactose metabolism
    C3V41_01275
  09102 Energy metabolism
   00680 Methane metabolism
    C3V41_01275
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    C3V41_01275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acto01009]
    C3V41_01275
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:acto03019]
    C3V41_01275
Enzymes [BR:acto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     C3V41_01275
Protein phosphatases and associated proteins [BR:acto01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     C3V41_01275
Messenger RNA biogenesis [BR:acto03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     C3V41_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AVM60932
UniProt: A0A2S0LKY2
LinkDB All DBs
Position
complement(306075..308477)
Genome map
AA seq 800 aa AA seqDB search
MAQPTTPPTTSTTAEPLRIGILTSGGDAQGMNAAVRAVVRTTLRLGAQPYAVMEGWAGAV
KGGDGIRPLAWDSVSSVLHRGGTIIGTARSAEFRTREGQLAAARNLLEHGIDHLVVIGGD
GSLTGTNVFRENWPSLVAELAEKGEISAQTAAEHPALIVTGLVGSIDNDLVGADMTIGTD
SALHRILEAIDDISSTAASHQRTFVVEVMGRHCGYLALMTAVAGGCDYVLVPELPPAEGW
EDDMCTKLRQGREAGRRESMVIVAEGATDRSGNRITADDVKQVLSERLGEDARVTILGHV
QRGGKPSAYDRWMSTLLGVAAAREVVTATADSEPVIFAERHNRIRALPMMEQVNATRAVK
DLVASGDYQGAVAARGASFGQMLQLFETMSTPPALDPAVHTQDEPDQAATAPPLPAPFRR
GPSIDTTSRADRPRRVAVVHAGGLAPGMNTAARAAVRLGLDHDFTMLGVHGGFPGLLDGD
VHALSWDDVEGWVGDGGAELGTRREVPTVEQLYALGRSIERHEIDALLVIGGFNAYLAAH
QLVTERDRYPAFKIPIVCVPASIDNNLPGSELSIGADTALNNAVRALDSIKQSAAASHRC
FVAEIMGRRCGYLSLMSGIATGAERVYLNEDGITLAGLARDTAGMVEAFRSGRELYLIVR
NERASVNYTTDVLAHIFAEEGHGLYDVRQAIIGHLQQGGDPTPFDRLMATKLVAHALRLL
ADQLDAGTAHSSYVGLTGGRITHHRLEHMNEELDRANRRPLNQWWMGLRGAIALVSQNAG
ILPLEEVPDFGASVDEAAAS
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggctcagccgacgacgccgcccaccacctccaccaccgccgagcccctgcggatcggg
atcctgacctccggcggcgacgcacagggcatgaacgccgccgtgcgcgccgtcgtacgc
accaccctgcgcctgggagcccagccctacgccgtcatggagggctgggccggggccgtc
aagggcggggacgggatccgccccctggcctgggactcggtctcctcggtcctccaccgc
ggagggactattatcggcaccgcccgctccgcggagttccgcacgcgcgagggccagctc
gccgccgcacgcaacctgctggagcacggcatcgaccacctggtggtcatcggcggcgac
ggctccctgaccggcaccaacgtgttccgggagaactggccctccctggtggccgagctg
gccgagaagggggagatcagcgcccagacggccgccgagcaccccgccctcatcgtcacc
ggcctggtcggctccatcgacaacgacctggtgggcgccgacatgaccatcggcaccgac
tccgccctccaccgcatcctggaggccattgacgacatctcctccaccgcggcctcccac
cagcgcaccttcgtggtggaggtcatgggacgccactgcgggtacctggcgctcatgacg
gccgtagccgggggatgcgactacgtgctggtccccgagctccccccggccgagggctgg
gaggacgacatgtgcaccaagctccgccagggccgcgaggccggacggcgcgagtccatg
gtcattgtggccgagggggccacggaccgctccggcaaccgcatcaccgccgacgacgtc
aagcaggtcctctccgagcgcctgggtgaggacgcccgggtgacgatcctgggccacgtc
cagcgcggtggcaagcccagcgcctacgaccgctggatgtccacccttctgggggtggcg
gccgcccgggaggtggtcaccgccaccgccgactccgagccggtcatcttcgccgagcgc
cacaaccgcatccgtgccctgcccatgatggagcaggtcaatgccacccgcgccgtcaag
gacctggtggccagcggggactaccagggggccgtggccgcccgtggagccagcttcggc
cagatgctgcagctcttcgagaccatgtccacgcccccggccctggacccggcggtccac
acccaggacgagccagaccaggccgctaccgccccaccgctgcccgcccccttccggcgc
ggcccgagcatcgacaccacgtcaagggccgaccgcccgcgccgggtggcggtcgtccac
gccgggggcctggccccgggcatgaacaccgccgcgcgcgccgccgtccgcctgggtctg
gaccacgacttcaccatgctgggcgtccacggcggcttccccgggctcctggacggcgac
gtccacgccctgtcctgggacgacgtcgagggctgggtcggagacggcggggccgagctg
ggcacccgccgtgaggtccccacggtggaacagctctacgccctgggacgctccatcgag
cgccacgagatcgacgccctgctggtcatcggcggcttcaacgcctacctggccgcccac
cagctggtcaccgagcgggaccgctaccccgccttcaagatcccgatcgtgtgcgtgccc
gcctcgatcgacaacaacctgcccggctccgagctgagtattggcgcggacacggccctg
aacaacgcggtgagggcgctggactccatcaagcagtccgccgcggcctcccaccgatgc
ttcgtggccgagatcatggggcgccgctgcggctacctcagcctcatgtccggcatcgcc
accggtgccgagcgcgtctacctcaacgaggacgggatcaccctggcggggctggcgcgg
gacacggccggcatggtggaggccttccgctccgggcgcgagctctacctcatcgtgcgc
aacgagcgcgccagcgtcaactacaccaccgacgtcctggcgcacatcttcgccgaggag
ggccacggcctgtacgacgtgcgccaggccattatcggccacctccagcagggcggggac
cccacgcccttcgaccgtctcatggccaccaagctcgtggcccacgccctgcgcctcctg
gccgaccagctcgacgcaggaaccgcccactcctcctacgtgggcctgaccggtgggcgg
atcacgcaccaccgcctggagcacatgaacgaggagctcgaccgcgccaaccgccgcccc
ctcaaccagtggtggatgggcctacgcggggcgatcgccctggtcagccagaacgccggg
atcctgccccttgaggaggtgccggacttcggcgcgagcgtggacgaggccgccgcgagc
tga

DBGET integrated database retrieval system