KEGG   Actinomyces sp. oral taxon 897: C3V41_04695Help
Entry
C3V41_04695       CDS       T05399                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00473  D-Alanine metabolism
acto00550  Peptidoglycan biosynthesis
acto01100  Metabolic pathways
acto01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C3V41_04695
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C3V41_04695
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C3V41_04695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:acto01011]
    C3V41_04695
Enzymes [BR:acto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C3V41_04695
Peptidoglycan biosynthesis and degradation proteins [BR:acto01011]
 Precursor biosynthesis
  Amino acid ligase
   C3V41_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AVM61477
UniProt: A0A2S0LMH3
LinkDB All DBs
Position
complement(1162853..1164034)
Genome map
AA seq 393 aa AA seqDB search
MPDTPQTLPVTSPSNSNPAGGRRTRVAVVFGGRSGEHTISCATAAGVLSAIDRRRYDVLP
IGVTRQGQWVLVDDDPAALELRGDEPPVEVTATGLGRGELTMRPGGGALSAVTPAGTHLL
GAVDVVLPLLHGPYGEDGTIQGLLEMMGLPYVGCGVLASAAGMDKQVTKVLLNAAGIPTA
PHVVVTPRAWHHDPAAVLKACAALAYPLFVKPARAGSSLGISKVDRPEDLSAAIGTAREV
DPKVLVESGVFGREIEVAVLGGHGDAAPRVAEPGEIRMDVSHGAGEFYDYRTKYLAHDAV
DMVCPAPLRPQERDQLMTTAARAFEALGGEGLARVDFFLTPQGTAVVNEVNTMPGFTPFS
MYPYMWQVSGLDYQDLITELIELALERPADVNR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacacaccccagaccctccccgtcacctccccctcgaactcgaaccctgctggc
gggcgcaggacgcgcgtcgccgtcgtcttcgggggccgcagcggggagcacaccatctcc
tgcgccaccgccgccggggtcctgtccgccattgaccgccggcgctacgacgtcctgccc
attggcgtgacccggcagggccagtgggtcctggtggacgacgaccccgcagccctggag
ctgcgcggggacgagccgccggtggaggtcacggccacgggcctgggacgcggcgagctg
accatgcgcccgggcggcggggcgctgagcgccgtcacccccgccggcacgcacctgctg
ggggccgtcgacgtcgtcctgcccctgctgcacggcccctacggggaggacggcaccatc
cagggcctgctggagatgatgggcctgccctacgtgggctgcggggtgctggccagcgcc
gccggcatggacaagcaggtcaccaaggtgctcctgaacgccgcgggcatccccaccgcc
ccgcacgtggtggtcaccccccgcgcatggcaccacgacccggccgccgtccttaaggcg
tgcgccgccctggcctaccccctgttcgtcaagcccgcccgcgccggctcctccctgggt
atcagcaaggtcgaccgccccgaggacctgtccgccgccattgggaccgcccgtgaggtg
gatcccaaggtcctggtcgagtccggggtcttcggccgcgagatcgaggtcgcggtcctg
ggcggtcacggcgacgccgccccgcgcgtggccgagcccggggagatcaggatggacgtc
tcccacggtgccggggagttctacgactaccgcaccaagtacctggcgcacgacgcggtg
gacatggtctgccccgccccgctgcgtccccaggagcgggaccagctcatgaccacggcc
gcccgggccttcgaggccctggggggcgagggcctggcgcgcgtggacttcttcctcacc
ccccaggggacggccgtcgtcaacgaggtcaacaccatgcccggcttcacccccttctcc
atgtacccctacatgtggcaggtctccggcctggactaccaggacctgatcaccgagctc
attgagctggccctggagcgccctgcggatgtcaaccgctga

DBGET integrated database retrieval system