KEGG   Actinomyces sp. oral taxon 897: C3V41_06415Help
Entry
C3V41_06415       CDS       T05399                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00564  Glycerophospholipid metabolism
acto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C3V41_06415
Enzymes [BR:acto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C3V41_06415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AVM62890
UniProt: A0A2S0LRH2
LinkDB All DBs
Position
1576138..1577811
Genome map
AA seq 557 aa AA seqDB search
MSSAEGLDVLVVGGGVTGAGIALDAAARGLRTGIVEMGDWASGTSSWSSKLIHGGLRYLY
QLNLALVHESLTERGRLLTTTAPHLVKAQPFLWPLRHHYERSYSAVGVGAYDALALVGAR
GRRTLPVQRHLGRRGTAALAPALDTSGLAGSIRFFDARVDDARLVIDLVRTAVGLGALAA
NRTRVTGFLTDGRGHVHGARVTDLATGTEHEIRARYTISATGVWTEEVQDLASADGGLKV
LASKGIHVVVPREAIDAQTGVFLRTEKSVLFIIPWPEYWVIGTTDTPWDLDVSRPVATAA
DVDYILAHANSVLARPITRDDIIGVYAGLRPLLQPRLRPGAQAASTKVSREHTVTRVVPG
LTAIAGGKLTTYRVMAADAVDHALGEALARTHPCATADLPLVGAAGYRALAARAGQIAAE
RGWRLERVTHLLDRYGDETPALLASIDAAEDPLARLGEPLESAPAYLRAEVAWAVTHEGA
ERLDDVLLRRVRLDVSRRDHGLGAADEILSVMTPLLGWTRQEAAAQKEAYAQRVSDITAA
EAEVTDAAAVAHLRQPV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggccgagggcctggacgtcctggtcgtcggcggcggggtcaccggggccggg
atcgccctggacgccgcagcccggggcctgcgcaccgggatcgtggagatgggcgactgg
gcctcgggcacctcctcgtggtcctccaagctcatccacggcgggctgcgctacctctac
cagctcaacctcgccctggtccacgagtccctcaccgagcgcggccgcctgctgaccacc
accgccccgcacctggtcaaggcccagcccttcctgtggccgctcaggcaccactacgag
cgctcctactccgccgtcggcgtgggcgcgtacgacgccctggccctggtcggcgcccgt
ggccgcaggaccctgccggtccagcgccacctggggcgcaggggcaccgcggccctggcc
cccgccctggacaccagcggcctggccgggtccatccgcttcttcgacgcccgggtcgac
gacgcccgcctggtcatcgacctggtgcgcaccgccgtcggcctgggggccctggccgcc
aaccgcaccagggtcaccggcttcctcaccgacgggcgcggccacgtccacggggcccgc
gtcaccgacctggccaccggtaccgagcacgagatccgtgccaggtacaccattagcgcc
accggggtgtggaccgaggaggtccaggacctggccagcgccgacgggggcctgaaggtc
ctggcctccaaggggatccacgtcgtggtgcccagggaagccattgacgcccagaccggc
gtcttcctgcgcaccgagaagtccgtcctgttcattatcccctggcccgagtactgggtg
atcggcaccaccgacaccccctgggacctggacgtctccaggccggtggccaccgccgcc
gacgtcgactacatcctggcgcacgccaactccgtcctggcccgccccattacccgggac
gacattatcggcgtctacgcgggcctgcgtcccctgctccagcccaggctcagaccgggg
gcgcaggcggcctccaccaaggtctcccgcgagcacaccgtcacccgtgtggtcccgggc
ctgaccgccatcgccggcggcaagctgaccacctaccgggtcatggcggccgacgccgtg
gaccacgccctgggcgaggccctggcccgcacccacccctgcgccacggccgacctgccc
ctggtgggggccgccggctaccgtgccctggcggcccgggcggggcagatcgccgccgag
cggggctggaggctggagcgggtcacccacctgctggaccgctacggggacgagaccccg
gccctgctggcctccattgacgccgccgaggaccccttggcccgcctgggtgagccgctg
gagtcggcccccgcctacctgcgcgccgaggtcgcctgggccgtcacccacgagggcgcc
gagcgcctggacgacgtcctgctgcgccgcgtgcgcctggacgtctcgcggcgcgaccac
ggcctgggtgccgccgacgagatcctctccgtcatgacccccctgctggggtggacccgg
caggaggcggccgcccagaaggaggcctacgcccagcgcgtgtcagacattaccgccgcc
gaggccgaggtcaccgacgccgcggccgtggcccacctcaggcagcccgtctga

DBGET integrated database retrieval system