KEGG   Actinomyces sp. oral taxon 897: C3V41_07875Help
Entry
C3V41_07875       CDS       T05399                                 

Definition
(GenBank) DUF1727 domain-containing protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00550  Peptidoglycan biosynthesis
acto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C3V41_07875
Enzymes [BR:acto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     C3V41_07875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M
Motif
Other DBs
NCBI-ProteinID: AVM61990
UniProt: A0A2S0LNW9
LinkDB All DBs
Position
1955424..1956812
Genome map
AA seq 462 aa AA seqDB search
MTAHSPRSRATVALGRAARLAARLRGGGSGGTAFPGLVMERADPGFLARTLGALPHGVIV
VSGTNGKTTTTKMVVDLLRASGLRVFTNRTGSNFVRGVLAALLTEVDASGHLDADIAVLE
LDEAHAVHFVRAVRPRACLLLNVMRDQLDRFGEIDYTASLLHTVAKATTGVVVVNADDPR
LAAPAFTEDLRARVASFGAGPALRSLFLSDDDLRTGQVSTLTDAAPGGQATVLLESLHGQ
DAVLSLAPHVAQAPDAPGTPGTSAASGTRSTHEVTFTIPGIHNQLNACAALALVLEVLGQ
DADVPAALRALSHVQAAFGRGEVLHLDGREVQLSLVKNPAGFRMGLLTAATAPGPETVMI
AINDEYADGRDMSWLWDVDFSALRAEGVAVVTGVRAWDMALRLAYDEVPAAAVEPDLSRA
LERVRTAARQADRPVRIFTTYTAMLALRARLGEITDVEEVMK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacactcaccgcgctcgcgcgccacagtggccctgggacgcgccgcgcgcctc
gccgcccgcctgcggggcgggggttccggcggcaccgccttccccggcctggtcatggag
cgggccgacccgggcttcctggcccggacactgggggccctgccccacggcgtcatcgtg
gtctccggcaccaacggcaagaccaccaccaccaagatggtggtcgacctcctgcgcgcg
tcgggcctgcgggtcttcaccaaccgcaccggcagcaacttcgtgcgcggcgtgctggcc
gccctgctcaccgaggtggacgcctccggccacctggacgccgacatcgccgtcctggag
ctggacgaggcccacgccgtccacttcgtgcgggcggtacgcccacgcgcatgcctcctg
ctcaacgtcatgcgcgaccagctcgaccgcttcggcgagatcgactacacggcctcccta
ctgcacacggtggccaaggccaccaccggcgtcgtcgtggtcaacgcggacgacccccgc
ctggccgcccccgccttcaccgaggacctcagggcgcgcgtcgcctccttcggcgccggg
cccgcgctacgctccctgttcctgtccgacgacgacctgcgcaccggccaggtgagcacc
ctgaccgacgccgcccccggcgggcaggccaccgtcctcctggagtccctgcacggccag
gacgccgtcctgtccctggcaccccacgtggcgcaggccccggacgcccccggcacaccg
ggcacctccgccgcgtccggcacccgctccacccacgaggtcaccttcaccatcccgggt
atccacaaccagctcaacgcttgcgcggccctggccctggtcctggaggtgctgggccag
gacgccgacgtcccggcggccctgagggccctgtcgcacgtccaagcggccttcgggcgc
ggggaggtcctccacctcgacggccgggaggtccagctgagcctggtgaagaacccggcg
ggcttccgcatggggctgctgaccgcggccacggcgcccggccccgagaccgtcatgatc
gccatcaacgacgagtacgccgacggccgggacatgtcctggctgtgggacgtggacttc
tcggccctgcgggccgagggcgtcgcggtggtcaccggcgtacgcgcctgggacatggcc
ctgcgcctggcctacgacgaggtgcctgccgccgccgtcgagccggacctgtccagggcc
ctggagcgggtgcgtaccgccgcccgccaggccgaccggcccgtacggatcttcaccacc
tacacggccatgctggccctgcgcgcccggctgggcgagatcaccgacgtcgaggaggtc
atgaagtga

DBGET integrated database retrieval system