KEGG   Actinomyces sp. oral taxon 897: C3V41_08390Help
Entry
C3V41_08390       CDS       T05399                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
acto  Actinomyces sp. oral taxon 897
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo ThiP_synth Kinase-like
Motif
Other DBs
NCBI-ProteinID: AVM62068
UniProt: A0A2S0LPE4
LinkDB All DBs
Position
2083342..2084796
Genome map
AA seq 484 aa AA seqDB search
MTQGRQGEPNTPPTIPGFTYLRFLGRGGYSTVYLYEQHMPRREVAVKVMNSDMGDDVAAR
FESEANLMAKVSTHPAILSVYGAGVSDEGSPFIVMEYCPPPSLGTILQREPLGVSQALST
AVQIAGAVETAHRAGIIHRDIKPANILFTHYRRPVLSDFGISAMSGPKQDGELRGMSVPW
APPEQLVGTDEARPLSDIYSLGATTYAMLSGRSPFDPDGTCKDVYSLSRRIITDPVPRLP
RKDAPPSLYNVLATAMEKRPENRYPTALAFARALQQVESELGLPCTTVDLLQEPGESLGR
PVAAEGEATRLGVFSKVPDAVVLPEAKDATEQQATQEPDRQAPGRSPLLRRALVLVLTTV
VAAGAVLGTILLSRQTDGPRPHATFATIAPGKEKSLEELPPPRNLTGVLTEDGKVTFTWE
PPTQDWADQYLYQEGSSPGASATTSSTSRTTVTVSARTGRTCLQVSSLRKGRTSSPTTAC
VETP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaggggcgtcagggggaacccaacacgccaccgaccatccccggattcacctac
ctgcgcttcctgggcaggggcgggtactccaccgtctacctctacgagcagcacatgccg
cggcgcgaggtcgcggtcaaggtcatgaactcggacatgggcgacgacgtcgccgcacgc
ttcgagtccgaggccaacctcatggccaaggtctccacccacccggcgatcctgtcggtc
tacggggcgggggtctccgacgagggcagccccttcatcgtcatggagtactgccccccg
ccctccctggggacgatcctccagcgcgagcccctgggggtgtcccaggcgctgagcacc
gcggtccagatcgccggggccgtggagaccgcccaccgcgccgggatcatccaccgcgac
atcaaaccggcgaacatcctgttcacccactaccgccgcccggtgctctccgacttcggg
atctcggccatgagcgggcccaagcaggacggggagctgcggggcatgagcgtgccctgg
gcgccccccgagcagctcgtgggcaccgacgaggcccggcccctgtccgacatctactcc
ctgggcgccaccacctacgcgatgctcagcgggcgcagccccttcgaccccgacggcacc
tgcaaggacgtctactccctgtcacgccggatcattaccgacccggtgccccgcctgccc
cgcaaggacgccccgccgtccctgtacaacgtcctggccacggccatggagaagcgcccc
gagaaccgctaccccaccgccctggccttcgcccgcgccctccagcaggtcgagagcgag
ctggggctgccgtgcaccaccgtggacctcctccaggagcccggggagagcctggggcgc
cccgtcgcggccgagggcgaggccacccggctgggggtgttcagcaaggtccccgacgcc
gtcgtgctgcctgaggccaaggacgccaccgagcagcaggccacccaggagccggaccgg
caggcgccgggacgctcccccctgctgcgccgcgccctggtcctggtgctgaccacggtg
gtggccgcgggggcggtgctgggcaccatcctgctgtcccggcagaccgacgggccccgg
ccccacgccaccttcgccaccatcgccccgggcaaggagaagtccctggaggagctgccg
ccgccgcgcaacctcaccggggtcctcaccgaggacgggaaggtgacctttacctgggag
ccgcccacacaggactgggccgaccagtacctctaccaggagggcagcagcccgggcgcg
tcggcgacgaccagctccacctccaggaccacggtgaccgtgtccgcgcgcaccggacgc
acctgcctgcaggtctccagcctgcgcaaggggcgtacctcaagcccgacgacggcctgc
gtcgagacgccctga

DBGET integrated database retrieval system