KEGG   Actinomyces sp. oral taxon 897: C3V41_09240Help
Entry
C3V41_09240       CDS       T05399                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C3V41_09240
Enzymes [BR:acto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C3V41_09240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 Glyco_hydro_42C Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AVM62191
UniProt: A0A2S0LPH7
LinkDB All DBs
Position
2311171..2313303
Genome map
AA seq 710 aa AA seqDB search
MATPPPPPSGRPRTATSPGTRSLPLPGTRLLYGADYNPEQWDPHVWREDVTLMHQAGVNT
VSLGIWSWALVEPTPGTFRFEWLDEILDLLQEAGIGVDLATPTAAPPAWFYRAHPEACLV
EADGTVRHGGSRGICCPHSPAYARAAERVTRALVEHVARRCATPADEGPRTAPVMWHVHN
EYGAPGGDCHCECSQAAFRTWLRERYGSLEALNRAWGTTFWGQVYGDWEEVTTPRHSGTA
LNPACELDYARFTSDSLLARFTVERDIIRAAFPQAPVTTNFMATNCPANDYWRWASQTDV
VSTDYYLEADSPVPQIWAALESDLTRSLAGGAPWLLMEHSVSAVSWQSHNRAKDPGQERR
TALAHVARGADGVMAFQWRASRRGAEKFHSAMIPHAGTDTRVFREVCELGAELAALSELR
GTRVRARVALTWDWESFWAQDLAWRPSSLMSHREQVRTTYRWLWERGTTVDLAHPEADLS
GYDVVIAPASYLVSQRACENLATFVERGGRLAALPFFAVVDAEECVHRGGAPGPLRDVLG
LSVEEIRPVPVGQEVHLAPTTRGEGRAVSASPLTGTLWSEDLRLEGAEPVWTALDGPTPG
PAVTAHRYGQGLAVYVSVLLDGQGLARVLEPLLNLPTDRPVVDGGARVPGLEAVTRYGVG
EREGTTYTILVNHDGVAHTAALAGTDVLTGEELDSVTLPAGDVRVVRSQL
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccgcccccgcccccctccgggcgaccccgcaccgcgaccagccccggcacc
aggagcctgcccctgcccggcacccgtctgctgtacggggccgactacaaccctgagcag
tgggatccgcacgtctggcgcgaggacgtcaccctcatgcaccaggccggggtcaacacc
gtgagcctgggaatctggtcctgggccctggtcgaaccgacaccagggaccttccgcttc
gagtggctcgacgagatcctggacctgctccaggaggcggggatcggcgtggacctggcc
accccgaccgccgccccacctgcctggttctaccgggcccatcccgaggcgtgcctggtc
gaggccgacggcacggtgcgccacggcggctcacgcggcatctgctgcccccactcaccg
gcctacgcacgtgccgccgaacgggtcacacgcgccctggtcgagcacgtcgccagacgc
tgcgccaccccggccgacgagggcccgcgcaccgccccggtcatgtggcacgtccacaac
gagtacggggccccgggcggggactgccactgcgagtgctcccaggccgccttccgtacc
tggttgcgcgagcgctacgggagcctggaggccctcaaccgggcctggggcacgaccttc
tgggggcaggtgtacggcgactgggaggaggtgaccaccccgcgccactccggtaccgcc
ctcaatcctgcctgcgagctggactacgcccgtttcacctccgactccctcctggcccgt
ttcaccgtcgagcgcgacattatccgcgccgccttcccccaggccccggtcaccaccaac
ttcatggccacgaactgcccggccaacgactactggcgctgggcgtcccagacggacgtc
gtgtccaccgactactacctggaggcggactcccccgtcccccagatctgggcggccctg
gagtccgacctcacccgctccttggcgggcggggccccctggctcctcatggagcactcc
gtctccgcggtgagctggcagtcccacaaccgtgccaaggaccccggtcaggagcgccgc
accgccctggcccacgtggcacggggagccgacggcgtcatggccttccagtggcgggca
tcacgacgtggggctgagaagttccactccgccatgatcccccacgccgggacggacacg
cgggtcttccgggaggtctgtgagctgggggccgagctcgccgccctgtccgagctgcgc
gggacccgggtccgggcgcgggtggcgctgacctgggactgggagtccttctgggcccag
gatctcgcgtggcgccccagcagcctcatgagccaccgcgagcaggtccgtaccacctac
cgctggctgtgggagcgcgggaccacggtcgacctggcccaccccgaggccgacctgtcc
ggctacgacgtcgtcatcgccccggcctcctacctggtctcacagcgggcctgcgagaac
ctggccaccttcgtggaacggggcgggcgcctggcggccctgcccttcttcgccgtcgtg
gacgccgaggagtgcgtgcaccgtggaggggccccgggccccttgcgcgacgtcctgggc
ctgagcgtggaggagatccggcccgtgcccgtaggccaggaggtgcacctggcacccacc
acccggggagagggacgagcggtcagcgcctcaccgctcaccgggacgctgtggtcggag
gacctccggcttgagggggctgagcccgtgtggacggccctggacggccccacacccgga
ccggccgtgaccgcgcaccgatacgggcaggggctggccgtctacgtgtcggtcctgctg
gacgggcaggggctggcccgcgtcctggaaccactgctcaacctgcccaccgaccgcccg
gtggtggacggcggggcacgggtgccgggcctggaggcggtcacccgctacggggtgggc
gagcgggagggcaccacctacacgatcctggtcaaccacgacggcgtcgcgcacacggcg
gccctggcgggcaccgacgtcctcaccggcgaggagctggatagcgtcacactgcctgcc
ggggacgtgcgcgtcgtgaggagccagctatga

DBGET integrated database retrieval system