KEGG   Actinomyces gaoshouyii: B6G06_02160Help
Entry
B6G06_02160       CDS       T04911                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
actp  Actinomyces gaoshouyii
Pathway
actp00010  Glycolysis / Gluconeogenesis
actp00030  Pentose phosphate pathway
actp00051  Fructose and mannose metabolism
actp00052  Galactose metabolism
actp00680  Methane metabolism
actp01100  Metabolic pathways
actp01110  Biosynthesis of secondary metabolites
actp01120  Microbial metabolism in diverse environments
actp01130  Biosynthesis of antibiotics
actp01200  Carbon metabolism
actp01230  Biosynthesis of amino acids
actp03018  RNA degradation
Module
actp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:actp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B6G06_02160
   00030 Pentose phosphate pathway
    B6G06_02160
   00051 Fructose and mannose metabolism
    B6G06_02160
   00052 Galactose metabolism
    B6G06_02160
  09102 Energy metabolism
   00680 Methane metabolism
    B6G06_02160
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    B6G06_02160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:actp01009]
    B6G06_02160
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:actp03019]
    B6G06_02160
Enzymes [BR:actp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B6G06_02160
Protein phosphatases and associated proteins [BR:actp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B6G06_02160
Messenger RNA biogenesis [BR:actp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     B6G06_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK T3SS_needle_E
Motif
Other DBs
NCBI-ProteinID: ARD42680
UniProt: A0A1V0KLQ6
LinkDB All DBs
Position
complement(531959..534283)
Genome map
AA seq 774 aa AA seqDB search
MACDTADGAAPTSPAGEPIRVGVLTSGGDAQGMNAAVRAAVRTLLRLGAQPFAVMEGWAG
AVAGGEGIRPLEWDSVGAILHRGGTIIGTARSAEFRERSGQLDAAANLLEHGINRLIVIG
GDGSLTGTNEFRKNWPGLVAELVETGRITARTAQAHPALMVAGIVGSIDNDLVGADMTIG
TDSALHRILEAIDDISSTAASHQRTFVVEVMGRHCGYLALMAAVAGGCDYVLVPEIPPAE
GWEEDMCAKLAKGRRAGRRESMVIIAEGATDRSGNRITADDVKRVLSERLGEDARVTILG
HVQRGGKPSAYDRWMSTLLGCQAAREVLQACPETVPVIVVERHNRIRSVPMMEQVEATRA
VKDLVAAGDWEGAVAARGRSFGEMLRIFETMSTPPEPTAAGAAPSRRVAIIHAGGLAPGM
NTAARAAVRLGLDHGFTMLGVTGGFPGLLDGEVRELSWDGVEGWVGDGGAELGTRREVPE
VEQLYALGRAIEKHEIDALLVIGGYNAYLAAHRLVTEKGRYPAFQIPILCVPASIDNNLP
GSELSIGTDTALNATISALDSIKQSAAASHRCFVAEVMGRKCGYLSFMSGLATGAEGVYL
HEGGIGLARLAEDSRRMVEAFKNGRKLHLLIRNERASEYYTTDVLAKIFAAEGVGLYDVR
EAVIGHLQQGGDPTAFDRLMATKLVAHALDLLADQLVKGTDHSSYVGLTGGRITHHRLER
MEDDLDMANRRPRHQWWLGMRPALDLVSSDLGPLSMADVPDFGEAVDAAATAED
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
ctggcctgcgatacggccgatggcgcggcgcccaccagcccagccggggagccgatccgg
gtcggtgtgctcacctcgggcggcgacgcccagggcatgaacgccgcggtgcgggccgcc
gtgcgcacgctgctgcgcctgggcgcccagcccttcgccgtcatggaggggtgggccggg
gccgtcgccgggggcgagggaatccgccccctggaatgggactccgtgggcgcgatcctc
caccggggcgggacgatcatcggcacggcccgctccgcggagttccgcgagcgctccggg
cagctcgacgccgccgccaatctcctggagcacggcatcaaccggctcatcgtgatcggc
ggggacggctccctgaccggcaccaacgagttccggaagaactggccgggcctggtggcc
gagctcgttgagaccgggcgcatcaccgcccggacggcccaggcgcatccggcgctcatg
gtggcggggatcgtcggctcgatcgacaacgacctcgtcggcgcggacatgacgatcggc
accgattcggccctgcaccgcatcctggaggccatcgacgacatctcctccaccgctgcc
tcccaccagcgcaccttcgtggtggaggtcatgggccgccactgcggctacctggcgctc
atggcggcggtggccggcggctgcgactacgtgctcgtgcccgagatcccgccggccgag
ggctgggaggaggacatgtgcgccaagctcgccaagggccggcgggccgggcggcgcgag
tccatggtcatcatcgccgagggggccactgaccgctccggcaatcggatcacggccgac
gacgtcaagcgggtcctgtccgagcgcctcggcgaggacgcccgggtgacgatcctcggg
cacgtccagcgaggcggcaagcccagcgcctacgaccgctggatgtccaccctgctggga
tgccaggcggcgcgcgaagtccttcaggcctgcccggagacggtaccggtgatcgtcgtc
gagcggcacaaccgcatccgctcggtgccgatgatggagcaggtcgaggccacgcgcgcg
gtcaaggacctggtagcggccggggactgggagggcgccgtggccgcccgggggcgcagt
ttcggcgagatgctgcggatcttcgagaccatgtccactccccccgagcccaccgccgcc
ggggccgcccccagcaggagggtggccatcatccatgccggcgggctcgctccgggaatg
aacacggcggcccgcgccgcagtccgcctcggcctggaccacggcttcaccatgctgggc
gtgacgggtggtttcccgggccttctcgacggcgaggtgcgcgagctcagctgggacggc
gtcgagggctgggtcggcgacggcggggccgagctcggcacgcgccgggaggtccccgag
gtcgagcagctctacgccctgggccgggccatcgagaagcatgagatcgacgccctgctc
gtcatcggcggctacaacgcctacctggccgcgcaccgcctggtcacggagaagggccgc
taccccgcgttccagatccccatcctgtgcgtcccggcgtcgatcgacaacaacctgccc
ggctccgagctgtcgatcggcacggacacggcgctcaacgcgacgatcagcgccctggac
tcgatcaagcaatcggcggcggcctcgcaccgctgcttcgtggcggaggtgatgggccgc
aagtgcggatacctgtccttcatgagcggcctggccacgggcgccgagggcgtctacctc
cacgagggcggcatcgggctggcgcgcctggcggaggactccaggcggatggtggaggcc
ttcaagaacggtcggaagctccacctgctcatccgcaatgagcgggccagcgagtactac
accacggatgtgctggccaagatcttcgccgccgagggcgtgggcctgtacgacgtgcgc
gaggccgtcatcgggcacctccagcagggcggtgaccccacggccttcgaccgcctcatg
gccaccaagctcgtcgcgcatgccctggacctgctcgccgaccagctcgtgaagggcacg
gatcactccagttacgtgggcctgaccggtgggcgcatcacccaccaccgcctggagcgc
atggaggatgacctggacatggccaaccgccgtccccgccatcagtggtggctggggatg
cgcccggccctggacctggtctcctcggacctcggcccgctgtccatggccgatgtcccc
gacttcggcgaggccgtggacgccgcggccaccgccgaggactga

DBGET integrated database retrieval system