KEGG   Actinomyces gaoshouyii: B6G06_02515Help
Entry
B6G06_02515       CDS       T04911                                 

Definition
(GenBank) tetrahydrofolate synthase
  KO
K11754  dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
actp  Actinomyces gaoshouyii
Pathway
actp00790  Folate biosynthesis
actp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B6G06_02515
Enzymes [BR:actp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     B6G06_02515
    6.3.2.17  tetrahydrofolate synthase
     B6G06_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ARD41386
UniProt: A0A1V0KI12
LinkDB All DBs
Position
631047..633008
Genome map
AA seq 653 aa AA seqDB search
MTHHQGSGGAASAEGEPTGRAENGAKGSHPGAAFGIPARATAEEVVDAVFGTGGASTGAR
DGGEGIDPGLLPYLEAADASAAGGGQDPSAPGRNLAEARRAAGERDEARSAAEAEDLAAL
RELVAHNMLASGDPDELDALLAEVDADGSDDWESWEPVLPDADGDPDGGQKADAARDGDP
GEGDAHRRALLAAARGVEVGERMRQVEAEILSRAPEHRVQPSLERIEAVMDILGHPERAY
RVIHITGTNGKTSTARMTERLLAAAGLRTGRFTSPHLATIRERISLDGEPISEEGFIAAW
EDVAPYIAMVDERSTAGGGPRMSFFEVLTVMALAVFADHPVDAAVIEVGMGGTWDCTNIV
DSDIEIITPIGLDHAAWLGSTIREVAENKAGIIKDGATLITSLQDPRAQEVIAAAATEHR
VVWRRELDPQEDPGEPGAGELSVRSRELAVGGQLVTLATAAAVYEDVFVPLHGEYQARNA
LLALAAVEAFFGGRALPPALVEEGFASTTSPGRLEVLRSSPTVIVDAGHNPHGVSALMPA
VEEAFGFTHLVAVMGAMADKDVEGILSVLEPACDAVVCVPIDSPRAMDVEDLGAVAREVF
GEHRVQVAQALADGVDRAVALSEGGDAPMTSSGVLIVGSVILAAEARALFRRP
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccaccagggatccggcggcgcggcgagcgctgagggcgagccgaccggtcgg
gccgagaacggcgccaagggctcccacccgggcgcggccttcggtattcccgcccgcgcc
accgccgaggaggtcgtcgacgccgtcttcggcaccgggggcgcaagcaccggggcccgg
gacggcggggaggggatcgaccccgggctcctgccctacctcgaggccgccgacgcctcc
gcggcgggcggggggcaggatccctccgcgccgggccgcaacctcgccgaggcccgccgg
gccgccggtgagcgggatgaggcgcgatcggcggccgaggccgaggacctggcggccttg
cgcgagctcgtcgcgcacaacatgctggcctcgggcgacccggacgagctcgacgcgctc
ctggccgaggtcgacgccgacggctccgatgactgggagtcctgggagccggtcctgccg
gacgccgatggcgatcccgacggagggcagaaggctgacgcggcgagggacggcgatccc
ggcgagggggacgcccaccgccgggccctgctggcggccgcccgcggcgtcgaggtgggc
gagcgcatgcggcaggtcgaggccgagatcctctcccgcgcccccgagcaccgcgtccaa
ccctccctggagcgcattgaggcggtgatggacatcctgggccaccccgagcgcgcctac
cgggtcatccacatcaccggcaccaacggcaagacctcgacagcccgcatgaccgagcgg
ctgctggcggccgcgggcctgcgcaccggcagattcaccagtccgcacctggccacgatc
cgcgagcgcatcagcctggacggcgagccgatcagcgaggagggcttcattgccgcatgg
gaggacgtcgccccctacatcgcgatggtcgatgagcgctccacggccgggggcggcccg
aggatgagcttcttcgaggttctcaccgtcatggcgctggcggtcttcgccgatcacccc
gtggacgccgccgttatcgaggtcggtatgggcggtacatgggactgcacgaatattgtg
gactccgatatcgagatcatcacccccatcggcctcgaccacgccgcctggctcggcagc
acgatccgcgaggtcgccgagaacaaggccggcatcatcaaggacggggccaccctcatc
acctcgctccaggatccccgggcgcaggaggtcatcgctgccgcggcaaccgagcaccgg
gtcgtgtggcgcagggagctcgatccccaggaggacccgggtgagccgggggccggcgag
ttgagcgtgcgctcgcgagaactggccgtgggcggccagctcgtcacgctggccacggcg
gccgccgtctacgaggacgtcttcgtgcccctccatggcgagtaccaggcgcgcaacgcg
ctactggcgctcgcggccgtcgaggccttcttcggggggcgcgcccttccaccggccctc
gtggaggagggcttcgcctcgacgacatccccggggcgcctggaggtcctgcggtcctcc
ccgaccgtcatcgtcgatgccgggcacaacccgcacggcgtgtcagccctcatgcccgcc
gttgaggaggccttcggcttcacgcatctcgtcgccgtcatgggcgccatggcggacaag
gacgttgaggggatcctatcggtcctcgagcccgcttgcgacgctgtcgtctgcgtgccc
atcgactcgccccgggccatggacgtcgaggacctgggggccgtcgcccgcgaggtcttc
ggggagcaccgcgtccaggtggcgcaggcgctcgccgacggcgtcgaccgcgccgtcgcg
ctctccgagggcggtgatgccccgatgacgtcctcgggcgtgctcatcgtgggctcggtg
atcttggccgccgaggcccgggccctgttccgccgcccctga

DBGET integrated database retrieval system