KEGG   Actinomyces gaoshouyii: B6G06_02530Help
Entry
B6G06_02530       CDS       T04911                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
actp  Actinomyces gaoshouyii
Pathway
actp00970  Aminoacyl-tRNA biosynthesis
actp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B6G06_02530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:actp03029]
    B6G06_02530
Enzymes [BR:actp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     B6G06_02530
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     B6G06_02530
Mitochondrial biogenesis [BR:actp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B6G06_02530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln CEP170_C
Motif
Other DBs
NCBI-ProteinID: ARD41388
UniProt: A0A1V0KI09
LinkDB All DBs
Position
635495..635800
Genome map
AA seq 101 aa AA seqDB search
MSAISSAEVARVASLARVALTDEEVTRLAGELDAVASSFARVTSVVTPDLPATSHPVPLA
NVLREDIPGPTLDVDELLAGAPVAEDSMFLVPQILGEESGS
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccatctcctccgccgaggtcgcgcgggtcgcgtcgctcgcgcgcgtggccctg
accgatgaggaggtgacgcgcctggctggtgagctggacgccgtcgcctcctccttcgcc
agggtcacctccgttgtcacccccgatctgcctgcgacctcccaccccgtgccgctggcc
aatgtcctgcgcgaggacatccccggcccgaccctcgatgtcgacgagctcctcgccggc
gctccggtggccgaggactccatgttcctcgtgccccagatcctcggagaggagtccggc
tcatga

DBGET integrated database retrieval system